IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Plant Cell (1040-4651) 2008 imex curation Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. xingwang.deng@yale.edu. 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. Transgenic Arabidopsis (ecotype Columbia) expressing FLAG tagged DCAF1 protein were used in this study. xingwang.deng@yale.edu. Accepted 2009-OCT-8 by JYOTI. 27-Oct-2007: Contacted by JYOTI. Plant Cell (1040-4651) 2008 jyoti Only protein-protein interactions imex curation Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Plant Cell (1040-4651) 2008 imex curation Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. xingwang.deng@yale.edu. 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. Antibodies used to detect CSN5, CSN6 and CSN7 in this paper will cross-react with isoforms CSN5A or CASN5B, CSN6A or CSN6B or CSN7i or CSN7ii. Due to the lack of specificity of the antibodies used , the correct isoform of the protein could not be unambiguously identified. Therefore interactions involving these proteins were not curated. xingwang.deng@yale.edu. Accepted 2009-OCT-8 by JYOTI. 27-Oct-2007: Contacted by JYOTI. Plant Cell (1040-4651) 2008 jyoti Only protein-protein interactions imex curation Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Plant Cell (1040-4651) 2008 imex curation Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. xingwang.deng@yale.edu. 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. xingwang.deng@yale.edu. Accepted 2009-OCT-8 by JYOTI. Plant Cell (1040-4651) 2008 jyoti Only protein-protein interactions imex curation Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. Plant Cell (1040-4651) 2008 imex curation Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. xingwang.deng@yale.edu. 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Feng S., Chen F., Chen H., Wang J., McCall C., Xiong Y., Deng XW. Transgenic Arabidopsis (ecotype Columbia) expressing FLAG tagged DCAF1 protein were used in this study. xingwang.deng@yale.edu. Accepted 2009-OCT-8 by JYOTI. 27-Oct-2007: Contacted by JYOTI. Plant Cell (1040-4651) 2008 jyoti Only protein-protein interactions imex curation cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA DIP protein P43254 original sequence version: 138 DIP protein P43254 original sequence version: 113 DIP protein P43254 original sequence version: 114 E6D9A1B702EAE8F0 det1_arath Light-mediated development protein DET1 DET1 Protein DEETIOLATED 1 T9A4.13 F28M11.100 At4g10180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFTSGNVTARVFERQIRTPPPGASVNRARHFYENLVPSYTLYDVESPDHCFRKFTEDGLFLISFSRNHQELIVYRPSWLTYSTTDDSTTTLPPLPRRASKFDSFFTQLYSVNLASSNELICKDFFLYHQTRRFGLFATSTAQIHDSSSPSNDAVPGVPSIDKITFVLLRLDDGVVLDERVFLHDFVNLAHNMGVFLYDDLLAILSLRYQRIHLLQIRDSGHLVDARAIGYFCREDDELFLNSSSQAMMSQDKSKQQSLSGSKEDDTGENGLRHSLSQPSGSNSFLSGVKQRLLSFIFREIWNEESDNVMRVQSLKKKFYFHFQDYVDLIIWKVQFLDRQHLLIKFGSVDGGVTRSADHHPAFFAVYNMETTDIVAFYQNSAEDLYQLFEQFSDHFTVSSSTPFMNFVTSHSNNVYALEQLKYTKNKSNSFSQFVKKMLLSLPFSCQSQSPSPYFDQSLFRFDEKLISAADRHRQSSDNPIKFISRRQPQTLKFKIKPGPECGTADGRSKKICSFLFHPHLPLAISIQQTLFMPPSVVNIHFRR D38354984D5F646A dcaf1_arath DDB1- and CUL4-associated factor homolog 1 At4g31160 DCAF1 Protein DDB1-CUL4 ASSOCIATED FACTOR 1 F6E21_80 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGQEHAEVPNSMVEDDQSVVAAEAIAELANSTGEPNPEEGEEQSVEDELIAKAQKLMEDITSVANNPNPNILHALSQLLESQESLFLEENGHFSNARGSHNSGKLCILIRENDEFFELISSTFLSENSYSTAVKAASARLLMNCSLTWMYPHVFDDAVTENFKNWVMEEAVKFPGEDSAKKEASDFEMLKTYSTGLLALSLASRGQIVEDVLTSGLSAKLMHYLRVRVLKEPSTSRIHTTETKHVSLKTKEEGRSRVRKIVDTVEGDHVLETDSGREMGQTDVQPDGEFEIDGRDVFNVSGVVDCKIKPGDDNSVRDDPSRHRLNRSKSRGRGRVHEGAPDTEVLLASPRLGRLLVRDRDLSKISDGRNAEDVTVCLGKMKSGIMEIEREDNDECFQGCIIGTKNITDLVKRAVGAAETEARAAHAPDDAAKAAGDAAAELVKTAALEEFKSSGSEEAAVSAATRAAITVIDAAEVSRNPTCVTSDQTTDVSEVSLPDIESLAQLQEKYCIQCLEILGEYVEVLGPVLHEKGVDVCIVLLERTSQLDDRSTVSPLLPDVMKLICALAAHRKFAAMFVERRGILKLLAVPRVSETFYGLSSCLYTIGSLQGIMERVCALPLVVIHQVVKLAIELLDCSQDQARKNSALFFAAAFVFRAILDAFDAQDSLQKLLAILKDAASVRTGANTDRSAPEVMTSSEKQMAFHTCFALRQYFRAHLLLLVDSIRPSRISRGGVPSSMKPNIRAAYKPLDISNEAVDAIFLQLQKDRRLGPTFVKAQWPAVNNFLASSGHVTMLELCQTPPVDRYLHDLLQYAFGVLHIVTSIPDGRKAIAHATLSNNRAGIAVILDAANISNSIVDPEIIQPALNVLINLVCPPPSLSNKPPLAQNHQPVPGQATTRPSTDVAVGTQSTGNAPQTPVAPASSGLVGDRRIFLGAGTGSAGLAAKLEQVYRQAREAVRGNDGIKILLKLLQPRIYVNPPATPDCLRALACRVLLGLARDDTIAQILTKLEVGKSLSELIRDSGGQSSGTDQGRWQAELAQVALELIGIVTNSGHATTLTASDAATPTLRRIERAAIAAATPITYDSKELLLLIHEHLQASGLGDTASALLKEAQLTPLPSSASPSSIAYSTTQEMSTPLAQEQWPSGRANSGFFTSKPKVCAHDEDPNSRSNAALSAKKKHLASSTLEMPTPVAQQQWPSGRANCGFCPSIPKINARDEDPSSRGNAAPSAKKKQLTFSPSFSSQSRKQSFSHDALPQSTQRINCCSNSDPALADTSETAAELVLKNDLDADAQFKTPISFPRKRKLSELRDSSVPGKRIDLGERRNSTFADGSGLQTPASALDANQSGSSRLGQMTPASQLRLPSDPQPSNPERLSLDSLVVQYLKHQHRQCLAPITTLPPVSLLHPHVCPEPKRLLEAPLNMTGRLGTRELQSFYSGVHGNRRDRQFVFSRFKSWRSFRDETALFTCIALLGGTNHIAVGSHAGEIKIFEASSGSMLESVSGHQAPVTLVQPYVSRDTQLLLSSSSSDVQLWDASSITGGPRHSFDGCKAAKFSNSGLQFAALSCEASRKDVLLYDVQTCSPCQKLTDTVTSSRSNPYSLVHFSPCDTLILWNGVLWDRRIPEKVRRFDQFTDYGGGGFHPSRNEVIINSEIWDMRTFKLLRSVPSLDQTAITFNSRGDVIYAMLRRNIEDVMSAVHTRRVKHPLFAAFRTLDAINYSDIATIPVDRCLLDFATEPTDSFLGLITMEDQEDMFSSARMYEIGRRRPTDDDSDPDDDDETEDEDEDDEEEDDLDRILGLAGDNSDSGDDDLSSEDNEDSVSDFDEEADILIDGDFMEELIEGENEDDGNGEDEDDDDDGEMQDFMSSGEEDDYRDNIRSS 822ECA9FB6BA3CE1 cop10_arath Constitutive photomorphogenesis protein 10 COP10 MRP15.21 At3g13550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMTPGGSGRLRPLPTAMYAGYSGTASSWVAKTSVSASGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFAK 6F255A398ECE901E ddb1a_arath DNA damage-binding protein 1a DDB1A C6L9.100 At4g05420 UV-damaged DNA-binding protein 1a protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSWNYVVTAHKPTSVTHSCVGNFTSPQELNLIVAKCTRIEIHLLTPQGLQPMLDVPIYGRIATLELFRPHGEAQDFLFIATERYKFCVLQWDPESSELITRAMGDVSDRIGRPTDNGQIGIIDPDCRLIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLFGCAKPTIAVLYQDNKDARHVKTYEVSLKDKDFVEGPWSQNSLDNGADLLIPVPPPLCGVLIIGEETIVYCSASAFKAIPIRPSITKAYGRVDVDGSRYLLGDHAGMIHLLVITHEKEKVTGLKIELLGETSIASTISYLDNAVVFVGSSYGDSQLVKLNLHPDAKGSYVEVLERYINLGPIVDFCVVDLERQGQGQVVTCSGAFKDGSLRVVRNGIGINEQASVELQGIKGMWSLKSSIDEAFDTFLVVSFISETRILAMNLEDELEETEIEGFLSQVQTLFCHDAVYNQLVQVTSNSVRLVSSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYLEIGDGKLTEVQHALLEYEVSCLDINPIGDNPNYSQLAAVGMWTDISVRIFSLPELTLITKEQLGGEIIPRSVLLCAFEGISYLLCALGDGHLLNFQMDTTTGQLKDRKKVSLGTQPITLRTFSSKSATHVFAASDRPTVIYSSNKKLLYSNVNLKEVSHMCPFNSAAFPDSLAIAREGELTIGTIDDIQKLHIRTIPLGEHARRICHQEQTRTFGICSLGNQSNSEESEMHFVRLLDDQTFEFMSTYPLDSFEYGCSILSCSFTEDKNVYYCVGTAYVLPEENEPTKGRILVFIVEDGRLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLLYKHEEGAIEERARDYNANWMSAVEILDDDIYLGAENNFNLLTVKKNSEGATDEERGRLEVVGEYHLGEFVNRFRHGSLVMRLPDSEIGQIPTVIFGTVNGVIGVIASLPQEQYTFLEKLQSSLRKVIKGVGGLSHEQWRSFNNEKRTAEARNFLDGDLIESFLDLSRNKMEDISKSMNVQVEELCKRVEELTRLH DIP protein Q9M0V3 original sequence version: 82 79071E5BC62A197E cul4_arath Cullin-4 CUL4 MDE13.3 At5g46210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLPTKRSTFSAASASDDSSYSSPPMKKAKNDLHHSPQHPNTADKVVGFHMEEDPTPAAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQMLMIRSIALTLDRKYVIQNPNVRSLWEMGLQLFRKHLSLAPEVEQRTVKGLLSMIEKERLAEAVNRTLLSHLLKMFTALGIYMESFEKPFLEGTSEFYAAEGMKYMQQSDVPEYLKHVEGRLHEENERCILYIDAVTRKPLITTVERQLLERHILVVLEKGFTTLMDGRRTEDLQRMQTLFSRVNALESLRQALSSYVRKTGQKIVMDEEKDKDMVQSLLDFKASLDIIWEESFYKNESFGNTIKDSFEHLINLRQNRPAELIAKFLDEKLRAGNKGTSEEELESVLEKVLVLFRFIQGKDVFEAFYKKDLAKRLLLGKSASIDAEKSMISKLKTECGSQFTNKLEGMFKDIELSKEINESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA DIP protein Q8LGH4 original sequence version: 63 6C1E21BFCB9141DF ddb1a-dcaf1 3 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey Q9M086:p.[Asp1658Ala;Arg1660Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:23:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1658ala,arg1660ala' Tue Jun 30 18:23:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1658Ala;Arg1660Ala]' Q9M086:p.[Asp1622Ala;Arg1624Ala;Asp1658Ala;Arg1660Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1622ala,arg1624ala,asp1658ala,arg1660ala' Tue Jun 30 19:49:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1622Ala;Arg1624Ala;Asp1658Ala;Arg1660Ala]' Q9M086:p.[Asp1622Ala;Arg1624Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:50:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1622ala,arg1624ala' Tue Jun 30 16:30:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1622Ala;Arg1624Ala]' physical association physical association Figure 2A Figure 3B Evidently, R3, R4, and R34 (R3 and R4) all are able to bind DDB1A independently, whereas the presence of R2 blocks R3's ability to bind to DDB1A (Figure 2A), supporting the idea that the R2 region plays a negative role in the DCAF1-DDB1 interaction. The authors do not provide the R3 or R4 domain amino-acid coordinates and therefore these were not curated. ddb1a-dcaf1-1 4 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2B when Flag-tagged fusion proteins were immunoprecipitated from plant extracts using anti-Flag antibody, endogenous DDB1 was detected together with R4-Flag and R34-Flag but not with R3-Flag. The authors do not provide the R3 or R4 domain amino-acid coordinates and therefore these were not curated. ddb1a-dcaf1-2 4 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association Figure 4A As expected, DCAF1 could be detected in the Flag-DDB1 immunocomplex pulled down with anti-Flag antibody ddb1a-dcaf1-3 1 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait physical association physical association Figure 4B reciprocally, Flag-DDB1 coimmunoprecipitated with DCAF1 that had been precipitated with anti-DCAF1 antibody (Figure 4B). These results confirm the interaction of Arabidopsis DCAF1 with DDB1 in vivo. ddb1a-dcaf1-4 1 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4C Using the anti-DCAF1 antibody, Flag-CUL4 from 35S:Flag-CUL4 transgenic Arabidopsis coimmunoprecipitated with DCAF1. ddb1a-dcaf1-5 4 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Figure 4D we tested the association of CUL4, DDB1, and DCAF1 in vivo and found that CUL4 and DDB1 coimmunoprecipitated together with DCAF1-Flag from 35S:DCAF1-Flag transgenic Arabidopsis ddb1a-dcaf1-6 2 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Figure 4E Figure 4F Figure 5C cop10-cop1-det1 4 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Figure 4G Moreover, unlike DDB1, COP1, or DET1, DCAF1 did not coimmunoprecipitate with Flag-COP10 in fractions from