IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The DELLA domain of GA INSENSITIVE mediates the interaction with the GA INSENSITIVE DWARF1A gibberellin receptor of Arabidopsis. The DELLA domain of GA INSENSITIVE mediates the interaction with the GA INSENSITIVE DWARF1A gibberellin receptor of Arabidopsis. Plant Cell (1040-4651) 2007 imex curation Willige BC., Ghosh S., Nill C., Zourelidou M., Dohmann EM., Maier A., Schwechheimer C. claus.schwechheimer@zmbp.uni-tuebingen.de 27-Oct-2007: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Willige BC., Ghosh S., Nill C., Zourelidou M., Dohmann EM., Maier A., Schwechheimer C. claus.schwechheimer@zmbp.uni-tuebingen.de Accepted 2009-NOV-5 by ORCHARD. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation The DELLA domain of GA INSENSITIVE mediates the interaction with the GA INSENSITIVE DWARF1A gibberellin receptor of Arabidopsis. The DELLA domain of GA INSENSITIVE mediates the interaction with the GA INSENSITIVE DWARF1A gibberellin receptor of Arabidopsis. Plant Cell (1040-4651) 2007 imex curation Willige BC., Ghosh S., Nill C., Zourelidou M., Dohmann EM., Maier A., Schwechheimer C. claus.schwechheimer@zmbp.uni-tuebingen.de 27-Oct-2007: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Willige BC., Ghosh S., Nill C., Zourelidou M., Dohmann EM., Maier A., Schwechheimer C. claus.schwechheimer@zmbp.uni-tuebingen.de Accepted 2009-NOV-5 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation gid1a_arath Gibberellin receptor GID1A GID1A At3g05120 T12H1.8 GID1-like protein 1 CXE10 GID1L1 AtCXE10 Carboxylesterase 10 Protein GA INSENSITIVE DWARF 1A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASDEVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNAEC DIP protein Q9MAA7 original sequence version: 74 DIP protein Q9MAA7 original sequence version: 85 FE1ED6E13BC1A48D rga_arath DELLA protein RGA RGA GRS RGA1 At2g01570 F2I9.19 Repressor on the ga1-3 mutant GAI-related sequence Restoration of growth on ammonia protein 1 GRAS family protein 10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRDHHQFQGRLSNHGTSSSSSSISKDKMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATDTVHYNPSELYSWLDNMLSELNPPPLPASSNGLDPVLPSPEICGFPASDYDLKVIPGNAIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAGESTRSVILVDSQENGVRLVHALMACAEAIQQNNLTLAEALVKQIGCLAVSQAGAMRKVATYFAEALARRIYRLSPPQNQIDHCLSDTLQMHFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPTFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADLDASMLELRPSDTEAVAVNSVFELHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLSTAAY DIP protein Q9SLH3 original sequence version: 84 DIP protein Q9SLH3 original sequence version: 75 DIP protein Q9SLH3 original sequence version: 102 FC92E7F9408072AA gai_arath DELLA protein GAI GAI RGA2 At1g14920 F10B6.34 Gibberellic acid-insensitive mutant protein Restoration of growth on ammonia protein 2 GRAS family protein 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRDHHHHHHQDKKTMMMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLATETVHYNPAELYTWLDSMLTDLNPPSSNAEYDLKAIPGDAILNQFAIDSASSSNQGGGGDTYTTNKRLKCSNGVVETTTATAESTRHVVLVDSQENGVRLVHALLACAEAVQKENLTVAEALVKQIGFLAVSQIGAMRKVATYFAEALARRIYRLSPSQSPIDHSLSDTLQMHFYETCPYLKFAHFTANQAILEAFQGKKRVHVIDFSMSQGLQWPALMQALALRPGGPPVFRLTGIGPPAPDNFDYLHEVGCKLAHLAEAIHVEFEYRGFVANTLADLDASMLELRPSEIESVAVNSVFELHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEGVPSGQDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHIGSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLSTN DIP protein Q9LQT8 original sequence version: 77 DIP protein Q9LQT8 original sequence version: 78 DIP protein Q9LQT8 original sequence version: 105 DIP protein Q9LQT8 original sequence version: 86 6464B8C129D79528 gid1l1-rga 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3D The GID1:GFP fusion protein coimmunoprecipitates with RGA in a GA-dependent manner Protein interaction shown to be Gibberellic acid (GA3) dependent. Gibberellic acid (GA3). gid1l1-gia 2 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 5 . In a complementary experiment, we observed that the GAI DELLA domain alone (amino acids 1 to 73) is sufficient to mediate GA-dependent interactions with GID1A and that the presence of the adjacent VHYNP domain (amino acids 1 to 115) does not contribute to the strength of this interaction. Thus, our results support the notion that the DELLA domain serves as a receiver domain for the GA receptor following GA binding and that the loss of this interaction is the molecular cause for the GA insensitivity observed in the previously reported dwarfing alleles of DELLA repressor genes from a range of species.