MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Intracellular protein interaction mapping with FRET hybrids. Intracellular protein interaction mapping with FRET hybrids. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction mimix curation human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation Intracellular protein interaction mapping with FRET hybrids. Intracellular protein interaction mapping with FRET hybrids. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction mimix curation yeast Saccharomyces cerevisiae Baker's yeast fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation Intracellular protein interaction mapping with FRET hybrids. Intracellular protein interaction mapping with FRET hybrids. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction mimix curation ecoli Escherichia coli (strain K12) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation Intracellular protein interaction mapping with FRET hybrids. Intracellular protein interaction mapping with FRET hybrids. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction mimix curation in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 suggested by mcarducci FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation pdz2-2 LAAMGFSHSALNTSV peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LAAMGFSHSALNTSV mint EC5C28602E789ECD pdz2-1 PSD-95 binding peptide-1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PAISVNRPPSYSTPV mint 3511C57D2E38E767 grap2_mouse GRB2-related adaptor protein 2 GADS protein Growth factor receptor-binding protein GRBLG GRB-2-like protein Hematopoietic cell-associated adaptor protein GrpL GRB-2-related monocytic adapter protein Adapter protein GRID Grap2 Gads Grb2l Grid Mona protein protein mouse Mus musculus Mouse MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR DIP protein O89100 original sequence version: 91 736311D0640CD3D0 mona-1 MONA binding peptide 1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) TSTPPLCPPRSAKAKVAKLGCFGG mint 69A540020F33D448 mona-5 MONA binding peptide-5 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VAPPPTPLWLYRDLP mint 5E376BE14E1774F9 mona-3 MONA binding peptide-3 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SAPARPPRTELPDLR mint 6B527D7D276B426B mona-8 MONA binding peptide-8 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LLVMGFRHILG mint B3A7022DF409C876 pdz2-10 PSD-95 binding peptide-10 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SYDLSSCSPPSWTL mint 8EA8324DBD4CAABE pdz2-6 PSD-95 binding peptide-6 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SPTCLFESFPVWTMV mint 8881019DAD963F0A nr2 IESDV peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) IESDV mint 72CAB5BB10300000 mona-4 MONA binding peptide-4 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) STAPAVCRLSKRCVR mint 7CDF10E44360F5EB mona-6 MONA binding peptide-6 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YCRSNSAVPPPLPPK mint DD64F4D7AFBFB60F mona-2 MONA binding peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ERPNRPAREFKFRCP mint 7D2EF3CF706E0415 pdz2-9 PSD-95 binding peptide-9 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PSGFPVTLMSVSSLV mint 5E81FEE32B082C87 pdz2-7 PSD-95 binding peptide-7 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SVPLGSAV mint DDCDC5B8773772D5 pdz2-3 RSTVV peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) RSTVV mint 72D2D1B5A4600000 p2 PAPSIDRSTKPPL peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PAPSIDRSTKPPL mint 895CED2361A5A40A pdz2-4 PSD-95 binding peptide-4 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PSAPHVTAMRYWTSV mint C793749E2B079C8D dlg4_human Disks large homolog 4 Postsynaptic density protein 95 Synapse-associated protein 90 DLG4 PSD95 protein protein human Homo sapiens Human MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P78352 original sequence version: 162 DIP protein P78352 original sequence version: 122 DIP protein P78352-1 original sequence version: 127 DIP protein P78352 original sequence version: 148 7922D3F220F9A101 pdz2-8 PSD-95 binding peptide-8 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SLTSEAQMSLRWTLV mint AFC261E4FB5D0F69 pdz2-5 PSD-95 binding peptide-5 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VVWWTVV mint 72D2D1B36362D2A0 grap2-mona_2 3 MONA-2 17 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 f3b domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction grap2-mona_1 3 MONA-1 8 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction f3c t1 grap2-p2 3 P2 21 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint f2d f3a t1 f4a FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction grap2-mona_4 3 MONA-4 15 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction t1 grap2-mona_3 3 MONA-3 10 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction t1 grap2-mona_5 3 MONA-5 9 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction t1 grap2-mona_8 3 MONA-8 11 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction t1 grap2-mona_6 3 MONA-6 16 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction t1 dlg4-pdz2_2 3 PDZ2-2 5 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint t1 f3e dlg4-pdz2_4 3 PDZ2-4 22 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint t1 f3f dlg4-pdz2_3 3 PDZ2-3 20 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_5 3 PDZ2-5 25 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_6 3 PDZ2-6 13 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_7 3 PDZ2-7 19 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_8 3 PDZ2-8 24 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_9 3 PDZ2-9 18 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_10 3 PDZ2-10 12 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-pdz2_1-1 3 PDZ2-1 6 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t1 domino mint dlg4-nr2 3 NR2 14 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PSD-95 23 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint t1 f3d grap2-p2-1 1 P2 21 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F4C domino mint grap2-p2-2 2 P2 21 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F4B domino mint grap2-p2-3 4 P2 21 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MONA 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2a f2b domino mint