IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. Plant Physiol. (0032-0889) 2006 imex curation Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr 01-Sep-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr Accepted 2009-AUG-30 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Plant Physiol. (0032-0889) 2006 orchard Only protein-protein interactions imex curation AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. Plant Physiol. (0032-0889) 2006 imex curation Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr 01-Sep-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr Accepted 2009-AUG-30 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Plant Physiol. (0032-0889) 2006 orchard Only protein-protein interactions imex curation AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. Plant Physiol. (0032-0889) 2006 imex curation Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr 01-Sep-2009: Contacted by JYOTI. orchard Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr Accepted 2009-AUG-30 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Plant Physiol. (0032-0889) 2006 orchard Only protein-protein interactions imex curation kin10_arath SNF1-related protein kinase catalytic subunit alpha KIN10 KIN10 AK21 SKIN10 SNR2 AKIN alpha-2 SNRK1.1 T4P13.22 At3g01090 AKIN10 SNF1-related kinase 1.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGSGTGSRSGVESILPNYKLGRTLGIGSFGRVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQAHLPRYLAVPPPDTVQQAKKIDEEILQEVINMGFDRNHLIESLRNRTQNDGTVTYYLILDNRFRASSGYLGAEFQETMEGTPRMHPAESVASPVSHRLPGLMEYQGVGLRSQYPVERKWALGLQSRAHPREIMTEVLKALQDLNVCWKKIGHYNMKCRWVPNSSADGMLSNSMHDNNYFGDESSIIENEAAVKSPNVVKFEIQLYKTRDDKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL 5A18655A0AA506DF hspr2_arath Nematode resistance protein-like HSPRO2 At2g40000 HSPRO2 AKINbetagamma-interacting protein 2 Ortholog of sugar beet HS1 PRO-1 protein 2 Protein Hs1pro-2 T28M21.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVDMDWKRKMVSSDLPNSPKLSSKLHVTIPSPFKIVPVSSPISCSAPALCSAYELYLRLPELRKLWSSRDFPQWTSEPILKPALQALEISFRLVFAVCSDTRPYINHREWNRRLDSLITKQIQLVAAICEDEEEEGISAEAPVGGGRSSLSLLPQLATWRRSEALGKKILYTIDNEMSRCKYTLGLGEQNIAGKPNLRYDAICRPNEIYSLKDNPYADHIDNHENQTLYIIHQILESWIYASGNLLNRIVSSIEEEKFGKASNDVYLLEKIWKILAEIEDLHMLMDPEDFLKLKKQLQIKSTGKNDAFCFRSKGLVEMMKMSKDLRQKVPAVLAVEVDPTGGPRLQEAAMKLYARKTECDKIHLLQGMQAVEAAAKSFFFGYRQLVAAMMGSAEMNATASQESCDSLSQIFMEPTYFPSLDAAKTFLGEFWSHLG A0121598C4C751B1 snf4_arath Sucrose nonfermenting 4-like protein CBS domain-containing protein CBSCBS3 SNF1-related protein kinase regulatory subunit betagamma F7G19.11 At1g09020 SNF4 CBSCBS3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQVICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFITGPDMVPAGFSPETLGRSNMDVDDVFLRTADPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVNLPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHTIAAWKEGKAHISRQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSLQDGSYPQLLHLASLSGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDASPPYGIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLGL 4545FE3BF2C4EBEC kinb1_arath SNF1-related protein kinase regulatory subunit beta-1 KINB1 T10F18.200 At5g21170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNANGKDEDAAAGSGGADVTSSSARSNGGDPSARSRHRRPSSDSMSSSPPGSPARSPSPFLFAPQVPVAPLQRANAPPPNNIQWNQSQRVFDNPPEQGIPTIITWNQGGNDVAVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVHNFVPENPESIVEFEAPPSPDHSYGQTLPAAEDYAKEPLAVPPQLHLTLLGTTEETAIATKPQHVVLNHVFIEQGWTPQSIVALGLTHRFESKYITVVLYKPLTR 116B50C319B5DDCA f4hzy9_arath Alkaline/neutral invertase CINV1 A N-InvG alkaline cytosolic invertase 1 neutral invertase G F15O4.33 At1g35580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGVGLRAVGSHCSLSEMDDLDLTRALDKPRLKIERKRSFDERSMSELSTGYSRHDGIHDSPRGRSVLDTPLSSARNSFEPHPMMAEAWEALRRSMVFFRGQPVGTLAAVDNTTDEVLNYDQVFVRDFVPSALAFLMNGEPDIVKHFLLKTLQLQGWEKRVDRFKLGEGVMPASFKVLHDPIRETDNIVADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLTLSETPECQKGMKLILSLCLAEGFDTFPTLLCADGCSMIDRRMGVYGYPIEIQALFFMALRSALSMLKPDGDGREVIERIVKRLHALSFHMRNYFWLDHQNLNDIYRFKTEEYSHTAVNKFNVMPDSIPEWVFDFMPLRGGYFVGNVGPAHMDFRWFALGNCVSILSSLATPDQSMAIMDLLEHRWAELVGEMPLKICYPCLEGHEWRIVTGCDPKNTRWSYHNGGSWPGLFSFPGD 213C556A160412B6 kinb2_arath SNF1-related protein kinase regulatory subunit beta-2 KINB2 dl4210w FCAALL.163 At4g16360 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNVNAREEANSNNASAVEDEDAEICSREAMSAASDGNHVAPPELMGQSPPHSPRATQSPLMFAPQVPVLPLQRPDEIHIPNPSWMQSPSSLYEEASNEQGIPTMITWCHGGKEIAVEGSWDNWKTRSRLQRSGKDFTIMKVLPSGVYEYRFIVDGQWRHAPELPLARDDAGNTFNILDLQDYVPEDIQSISGFEPPQSPENSYSNLLLGAEDYSKEPPVVPPHLQMTLLNLPAANPDIPSPLPRPQHVILNHLYMQKGKSGPSVVALGSTHRFLAKYVTVVLYKSLQR FF76EAD739E0CEBB kin11_arath SNF1-related protein kinase catalytic subunit alpha KIN11 KIN11 AKIN alpha-1 AKIN11 SNF1-related kinase 1.2 SNR1 SNRK1.2 MXE2.16 At3g29160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDHSSNRFGNNGVESILPNYKLGKTLGIGSFGKVKIAEHVVTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSRCNIKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWFQTHLPRYLAVSPPDTVEQAKKINEEIVQEVVNMGFDRNQVLESLRNRTQNDATVTYYLLLDNRFRVPSGYLESEFQETTDSGSNPMRTPEAGASPVGHWIPAHVDHYGLGARSQVPVDRKWALGLQSHAHPREIMNEVLKALQELNVCWKKIGHYNMKCRWVPGLADGQNTMVNNQLHFRDESSIIEDDCAMTSPTVIKFELQLYKAREEKYLLDIQRVNGPQFLFLDLCAAFLTELRVI 4FBEF55D3EC60F87 hspr1_arath Nematode resistance protein-like HSPRO1 HSPRO1 AKINbetagamma-interacting protein 1 Ortholog of sugar beet HS1 PRO-1 protein 1 Protein Hs1pro-1 F27K19.20 At3g55840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADLDLQRKMVSPKLHVTIPEPCKLSSVSSPISSSSSAACSAYELYLRLPELRNLWSSLYFPHWISEPVLKPALQALEITFRLILTVASDTRPYINRREWIRRLDSLTTSQIKIVAAICGDEDNYEENVSAAPVSNGWSSLSLLSEIATCRTSESVGQKILSTIENEMRWCKYTLGLGEPNLAGKPYLQYDAVCLPEELHSLKNNPYADHIENQENQMLYTSHQILESWIYVSVNLLYRIESRIEEGKFEKASSDVYLLERIWKLLSEIEDLHILMDPEDFLKVKKQLQIKSTFPNDAFCFRSKGLVEMAKMSKELRQKVPAVLEVEVDPTGGPRLQEAAMKLYSRKTEYEKIHLLQGMQAVESAAKRFFFGYQKLVAAMIGNAEANANRTVANHESYDSLTQVFMEPPYYPSLDAAKTFLGEFWSQL 278D0A023953D07A kinb3_arath SNF1-related protein kinase regulatory subunit beta-3 F24D13.15 T1E2 At2g28060 KINB3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSQNPDDHEDTTVVGFEVPVSPVSSYNNVYSSTEDETRDPPAVPPHLQHSLLGNQGSMELAYAPQNVVLNHLYIENRDAPRSVVALGFSHRFRTKFVTVVIYKPVQRRGSANV 16A1737BCB764343 akin11-snf4 2 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 2A Interactions between AKINβγ/βγI and the AKINα1 and α2 kinases by two-hybrid experiments It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. akin10-snf4-1 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 2A Interactions between AKINβγ/βγI and the AKINα1 and α2 kinases by two-hybrid experiments It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. akin10-snf4-2 1 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 2B Interactions between AKINβγ/βγI and the AKINα1 and α2 kinases by two-hybrid experiments and in vitro binding assays. kinb1-snf4-1 2 7 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2360693]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 284-284, sequence length 283 [EBI-2360693]216-284 6 unspecified role unspecified role prey prey physical association physical association Figure 3B Interactions have been detected between AKINβγ and each of the three β-subunits (AKINβ1, β2, and β3 It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. There is a slight difference between lengths of the bait protein in the text the length is given as 284 amino acids in the UniProt record this is 283 amino acids. kinb2-snf4-2 2 9 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Figure 3B Interactions have been detected between AKINβγ and each of the three β-subunits (AKINβ1, β2, and β3 It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. akin_beta3-snf4-3 2 12 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Figure 3B Interactions have been detected between AKINβγ and each of the three β-subunits (AKINβ1, β2, and β3 It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. kinb2-snf4-3 3 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3A All combinations led to a YFP signal showing a clear in planta interaction between YN-AKINβγ- and YC-AKINβ-subunits. akin_beta3-snf4-4 3 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3A Interestingly, the YFP signal is located both in the cytoplasm and the nucleus, as presented in Figure 3A, for a classical β-subunit (YN-AKINβγ/YC-AKINβ2 interaction) and for the plant-specific one (YN-AKINβγ/YC-AKINβ3 interaction). kinb1-snf4-3 1 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 3C kinb2-snf4-4 1 9 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 3C snf4-hspro1 2 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 7B Protein-protein interaction between AtHSPRO1/2 and AKINβγ/βγKIS It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. snf4-hspro2-1 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Figure 7B Protein-protein interaction between AtHSPRO1/2 and AKINβγ/βγKIS It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. snf4-hspro2 3 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 7A were confirmed by BiFC experiments performed between YN-AKINβγ and YC-HSPRO1 or YC-HSPRO2. Indeed, YFP signals were detected in the cytoplasm for both YN-AKINβγ/YC-HSPRO1 and YN-AKINβγ/YC-HSPRO2, confirming the in planta interaction between AKINβγ and HSPRO1/2 snf4-hspro1-2 3 8 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 7A were confirmed by BiFC experiments performed between YN-AKINβγ and YC-HSPRO1 or YC-HSPRO2. Indeed, YFP signals were detected in the cytoplasm for both YN-AKINβγ/YC-HSPRO1 and YN-AKINβγ/YC-HSPRO2, confirming the in planta interaction between AKINβγ and HSPRO1/2 hspro1-snf4-4 1 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 7C hspro2-snf4-5 1 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 7C