MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. J. Biol. Chem. (0021-9258) 2006 Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2006 Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. J. Biol. Chem. (0021-9258) 2006 Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2006 Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. J. Biol. Chem. (0021-9258) 2006 Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci in vitro In vitro pull down pull down predetermined predetermined participant predetermined Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2006 Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain. J. Biol. Chem. (0021-9258) 2006 Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Moncalián G., Cárdenes N., Deribe YL., Spínola-Amilibia M., Dikic I., Bravo J. SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2006 cblb_human E3 ubiquitin-protein ligase CBL-B Signal transduction protein CBL-B SH3-binding protein CBL-B Casitas B-lineage lymphoma proto-oncogene b RING finger protein 56 CBLB RNF56 Nbla00127 RING-type E3 ubiquitin transferase CBL-B protein protein human Homo sapiens Human MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTSPGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLNSQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRLNL B4E307D31B9F0779 cd2ap_human CD2-associated protein CD2AP Cas ligand with multiple SH3 domains Adapter protein CMS protein protein human Homo sapiens Human MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPPPPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS DIP protein Q9Y5K6 original sequence version: 92 DIP protein Q9Y5K6 original sequence version: 94 DIP protein Q9Y5K6 original sequence version: 98 7576509C7ED5B343 cbl_human E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene RING finger protein 55 CBL CBL2 RNF55 RING-type E3 ubiquitin transferase CBL protein protein human Homo sapiens Human MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT DIP protein P22681 original sequence version: 173 DIP protein P22681 original sequence version: 128 DIP protein P22681 original sequence version: 145 DIP protein P22681 original sequence version: 150 DIP protein P22681 original sequence version: 191 DIP protein P22681 original sequence version: 91 DIP protein P22681 original sequence version: 139 1AA6BF67377322CA cd2_human T-cell surface antigen CD2 CD2 SRBC Erythrocyte receptor LFA-2 LFA-3 receptor Rosette receptor T-cell surface antigen T11/Leu-5 protein protein human Homo sapiens Human MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN A03D853C3B618917 cblb-cd2ap 4 Cbl-b 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041383: original sequence: 902-912 : PARPPKPRPR CMS 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041373: original sequence: 1-61 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE CMS 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041378: original sequence: 1-61 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE physical association physical association homomint domino mint f1a t1 cd2-cd2ap 4 CMS 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041407: original sequence: 1-61 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE CMS 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041402: original sequence: 1-61 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE CD2 8 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041397: original sequence: 324-333 : APSGTQVHQQKGPPLPRPRVQPKPPHGAA physical association physical association homomint domino mint f1c t1 cd2ap-cblb 3 CMS 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041422: original sequence: 1-61 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE Cbl-b 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041417: original sequence: 902-912 : PARPPKPRPR physical association physical association f2a homomint domino mint cd2ap-cbl-1 3 CMS 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041437: original sequence: 1-61 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE c-Cbl 7 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041432: original sequence: 824-829 : TEGSQVPERPPKPFPRRINSERKAG physical association physical association f2b homomint domino mint cbl-cd2ap 2 CMS 6 unspecified role unspecified role prey prey flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-Cbl 7 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041447: original sequence: 824-829 : TEGSQVPERPPKPFPRRINSERKAG physical association physical association f2c homomint domino mint cblb-cd2ap-1 2 CMS 6 unspecified role unspecified role prey prey flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cbl-b 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041459: original sequence: 902-912 : PARPPKPRPR physical association physical association f2c homomint domino mint cd2ap-cblb-1 1 Cbl-b 5 unspecified role unspecified role prey prey undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:05:41 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Arg927Ala range MINT-7041505: original sequence: 927-927 : IHHRKPHGPEAALENVDAKI CMS 6 unspecified role unspecified role prey prey myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CMS 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041510: original sequence: 1-330 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQIN flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association homomint f2f domino mint the co-precipitation between CMS molecules is a consequence of direct binding of two indipendent CMS molecules to a single Cbl-b molecule cd2ap-cbl-2 1 CMS 6 unspecified role unspecified role prey prey myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CMS 6 unspecified role unspecified role bait bait flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041487: original sequence: 1-330 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQIN c-Cbl 7 unspecified role unspecified role prey prey P22681:p.Arg829Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:51:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:49:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg829ala' Tue Jun 30 17:07:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg829Ala' range MINT-7041537: original sequence: 829-829 : VPERPPKPFPRRINSERKAG association association f2e homomint domino mint The co-precipitation between CMS molecules is a consequence of direct binding of two indipendent CMS molecules to a single c-Cbl molecule