UniProt UniProt http://www.uniprot.org The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. J. Cell Biol. (0021-9525) 2006 imex curation Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org 21-Dec-2010: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org Accepted 2009-JUL-3 by DAVET. 21-Dec-2010: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2006 davet Only protein-protein interactions imex curation The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. J. Cell Biol. (0021-9525) 2006 imex curation Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org 21-Dec-2010: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org Accepted 2009-JUL-3 by DAVET. 21-Dec-2010: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2006 davet Only protein-protein interactions imex curation The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. J. Cell Biol. (0021-9525) 2006 imex curation Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org 21-Dec-2010: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org Accepted 2009-JUL-3 by DAVET. 21-Dec-2010: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2006 davet Only protein-protein interactions imex curation The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. J. Cell Biol. (0021-9525) 2006 imex curation Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org 21-Dec-2010: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro biochemical biochemical tag fluorescence tag visualisation by fluorescence tag fluorescence Jaspersen SL., Martin AE., Glazko G., Giddings TH., Morgan G., Mushegian A., Winey M. assay is a kind of overlay of proteins on nitrocellulose probed with Alexa tagged prey. Competition experiment where the binding of Alexa-labelled, wild type MPS3 protein (457-617) was assessed in the presence of unlabelled wild type MPS3 protein or MPS3 protein mutants. slj@stowers-institute.org Accepted 2009-JUL-3 by DAVET. J. Cell Biol. (0021-9525) 2006 davet Only protein-protein interactions imex curation mps3_yeast Spindle pole body assembly component MPS3 J1310 J1315 YJL018W YJL019W MPS3 NEP98 Monopolar spindle protein 3 98 kDa nuclear envelope protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNSNEHRREEAGAANEQMPYNKAVKSAYADVLKDKMNREQEISLRAIKKGIYTDGGETDNYDMDKENDSAYEMFKKNLDFPLDQHNDDDDDDPYIEDNGQETDGYSDEDYTDEADKSFIEDSDSDSYDLESNSDFEENLESSGEAKKLKWRTYIFYGGLFFVFYFFGSFLMTTVKNNDLESHSSGATSSPGKSFSNLQKQVNHLYSELSKRDEKHSSELDKTVKIIVSQFEKNIKRLLPSNLVNFENDINSLTKQVETISTSMSELQRRNHKFTVENVTQWQDQLVKQLDTHLPQEIPVVINNSSSLLIIPELHNYLSALISDVIESPGIGTAGSAESRWEYDLNRYVKEILSNELQYIDKDYFIQEMNRRLQSNKQEIWEEITNRLETQQQQQQQQVQQDYSNVPQQYSSILMKRLIHQIYNSNQHQWEDDLDFATYVQGTKLLNHLTSPTWRQGSGVQPIELLTDSKQSSSTYWQCENEPGCSWAIRFKTPLYLTKISYMHGRFTNNLHIMNSAPRLISLYVKLSQTKEIKALQTLANQYGFGQHHKRDRNYIKIAKFEYRLTDSRIRQQMYLPPWFIQLKPLVRSIVFQVDENYGNKKFISLRKFIINGVTPQDLQIIENNEFPVLLGDTPEYGVTQNTDEGKRKVLLSKPPYASSSTSTKFHPASNVPSFGQDELDQ 71B54CEB2B876815 mps2_yeast Monopolar spindle protein 2 YGL075C MPS2 MMC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSEINKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLNSPSKFLVENKNKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSLLQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQKAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISAVPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWFFEDQTDLETEYRSNANVDDAYSRVFGI CF8AFA86EDEA834C cdc31_yeast Cell division control protein 31 YOR257W CDC31 DSK1 Nucleoporin CDC31 Nuclear pore protein CDC31 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS 25A546E76E1EF520 25A546E76E1EF520 mps2-mps3-1 4 6 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey P47069:p.Trp477Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:53:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp477ala' Tue Jun 30 19:58:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp477Ala' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P47069:p.Trp487Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:25:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp487ala' Tue Jun 30 17:43:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp487Ala' P47069:p.[Gln572Leu;Gln573Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 20:03:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln572leu,gln573leu' Tue Jun 30 19:50:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln572Leu;Gln573Leu]' ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 4A, 4B mps3-mps2-1 2 6 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 4C mps3-cdc31-2 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 4C mps2-mps3-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D mps2-mps3-3 3 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 5D