IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ARL1 plays a role in the binding of the GRIP domain of a peripheral matrix protein to the Golgi apparatus in plant cells. ARL1 plays a role in the binding of the GRIP domain of a peripheral matrix protein to the Golgi apparatus in plant cells. Plant Mol. Biol. (0167-4412) 2006 imex curation Stefano G., Renna L., Hanton SL., Chatre L., Haas TA., Brandizzi F. federica.brandizzi@usask.ca 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Stefano G., Renna L., Hanton SL., Chatre L., Haas TA., Brandizzi F. federica.brandizzi@usask.ca Accepted 2009-JUN-13 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Plant Mol. Biol. (0167-4412) 2006 jyoti Only protein-protein interactions imex curation ARL1 plays a role in the binding of the GRIP domain of a peripheral matrix protein to the Golgi apparatus in plant cells. ARL1 plays a role in the binding of the GRIP domain of a peripheral matrix protein to the Golgi apparatus in plant cells. Plant Mol. Biol. (0167-4412) 2006 imex curation Stefano G., Renna L., Hanton SL., Chatre L., Haas TA., Brandizzi F. federica.brandizzi@usask.ca 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Stefano G., Renna L., Hanton SL., Chatre L., Haas TA., Brandizzi F. federica.brandizzi@usask.ca Accepted 2009-JUN-13 by JYOTI. Plant Mol. Biol. (0167-4412) 2006 jyoti Only protein-protein interactions imex curation arf3_arath ADP-ribosylation factor 3 ARF3 F27A10.8 F27C12.31 At2g24765 ARL1 Protein ARF-LIKE 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLKSGSG F5271FBBC69BAD7D grip_arath Protein GRIP GRIP K2A18.10 At5g66030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSEDKESDVVGEEEESHVIKEDKELNDASNETLTENGDQLLQMIAELRLENDFLRSQFEGLKDEVAQGRSLQKAEQVEADSAQLKQLQEQVASLSREIDVEKQTRVAAEQALEHLREAYSEADAKSQEYSSKFSQVEQKLDQEIKERDEKYADLDAKFTRLHKRAKQRIQEIQKEKDDLDARFREVNETAERASSQHSSMQQELERTRQQANEALKAMDAERQQLRSANNKLRDTIEELRGSLQPKENKIETLQQSLLDKDQILEDLKKQLQAVEERKQIAVTELSAKHQKNLEGLEAQVVDALSERDKAAETISSLQVLLAEKESKIAEMEAAATGEAARLRAAAETLKGELAHLKSENEKEKETWEASCDALKSKLEIAESNYLQAEIEVAKMRSQLGSEMSMQTQILSTKDAELKGAREEINRLQSEFSSYKIRAHALLQKKDMELAAAKDSEQIKSLEEALKEAEKEVYLVSAERDRAQQDLQSALASLEKELEERAGALKDASEQIKSLEVKLDSTVARNQAEKQAWEEDLRVLEETWRRRCEALTAQNEASPAEGIEKELENAKLRNKRMKEEHESVRELADRLIEEKDREISRLVDEMTNLRKSMESKPVWNKSPSQVHHYGNNNTESQQQDVSNLSTSAAEHQILILARQQAQREEELAQTQRHILALQEEIEELERENRLHSQQEAVLKTELREMERKQKREGVDMTYLKNVILKLLETGEVEALLPVVGMLLQFSPEEIQKCQQAYHSSTTAATTTEATPSPASEGSGLSVFSRFSFS C2B98C5E8A20B10F arl1-grip-2 2 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf physical association physical association Figure 3B tobacco leaves expressingYFPfusions of ARL1GDP and ARL1GTP were preloaded with non-hydrolysable analogues of GDP or GTP and then incubated with GST-GRIP on glutathione-agarose beads (Figure 3B, lanes 6 and 7). We found that both proteins were retained by GST-GRIP. arl1-grip-3 2 3 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P40940:p.Tyr81Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y G Wed May 02 18:49:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr81gly' Tue Jun 30 18:47:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr81Gly' P40940:p.Phe51Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F G Wed May 02 16:38:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe51gly' Tue Jun 30 17:31:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe51Gly' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8S2T0:p.Tyr717Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:06:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr717ala' Tue Jun 30 18:48:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr717Ala' Q8S2T0:p.Lys719Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:04:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys719ala' Tue Jun 30 15:58:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys719Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3C Figure 4 Figure 7 Interaction of recombinant ARL1 with GSTGRIP in vitro The authors noted that "in comparison to wild-type GRIP, with the tyrosine mutant showing a stronger effect than lysine mutant". arl1-grip-4 1 4 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component P40940:p.Tyr81Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y G Wed May 02 16:28:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr81gly' Tue Jun 30 17:37:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr81Gly' region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40940:p.Phe51Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F G Wed May 02 15:30:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe51gly' Tue Jun 30 20:24:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe51Gly' colocalization colocalization Figure 9 Such an association was similar to that in the presence of wild-type ARL1-CFP (Supplementary data 3). In contrast, co-expression with the two mutants led to a re-distribution of the GRIP fusion to the cytosol (Figure 9D�F and G�I). Taken together, these results are consistent with our prediction that intact ARL1 F51 and Y81 residues are involved in the ARL1-mediated binding of YFP-GRIP and directly support the hypothesis that ARL1 plays a role in the recruitment of GRIP to the Golgi apparatus in live plant cells.