MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. J. Mol. Biol. (0022-2836) 2006 mimix curation Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu mimix curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. J. Mol. Biol. (0022-2836) 2006 mimix curation Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu mimix curation in vitro In vitro fcs fluorescence correlation spectroscopy FCS FCS fcs predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. J. Mol. Biol. (0022-2836) 2006 mimix curation Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu mimix curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. J. Mol. Biol. (0022-2836) 2006 mimix curation Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu mimix curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 suggested by mcarducci hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR DIP protein Q13177 original sequence version: 166 DIP protein Q13177 original sequence version: 114 00A7CD15F93D4180 arhg7_rat Rho guanine nucleotide exchange factor 7 Arhgef7 Pak3bp Pixb Beta-Pix PAK-interacting exchange factor beta protein protein rat Rattus norvegicus (Rat) Rat MTDNANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETEHEYSKELQSVLSTYLWPLQTSEKLSSANTSYLMGNLEEISSFQQVLVQSLEECTKSPEAQQRVGGCFLSLMPQMRTLYLAYCANHPSAVSVLTEHSEDLGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILTEPIRSWEGDDIKTLGSVTYMSQVTIQCAGSEEKNERYLLLFPNLLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVEHLQRQTKVTSVSNPTIKPHSVPSHTLPSHPLTPSSKHADSKPVALTPAYHTLPHPSHHGTPHTTISWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSRSPKTMKKLLPKRKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL DIP protein O55043 original sequence version: 116 17CDE7DD96ADEA53 arhgef7-pak2 4 PAK 2 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Beta-Pix 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 f1c arhgef7-pak2-1 4 Beta-Pix 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PAK 2 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 arhgef7-pak2-2 4 PAK 2 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Beta-Pix 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 arhgef7-pak2-3 3 PAK 2 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 2.2 Beta-Pix 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 2.2 direct interaction direct interaction homomint mint t1 f3a f3b f4a f4b f4c arhgef7-pak2-4 1 PAK 2 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.1 Beta-Pix 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.1 direct interaction direct interaction homomint mint f1b arhgef7-pak2-5 2 PAK 2 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Beta-Pix 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 f1d arhgef7-pak2-6 2 PAK 2 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Beta-Pix 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 arhgef7-pak2-7 2 PAK 2 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Beta-Pix 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2