IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Caveolae: biochemical analysis. Caveolae: biochemical analysis. Mol. Biol. Rep. (0301-4851) 2004 imex curation Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel davet Only protein-protein interactions bovin-pulmonary_artery Bos taurus pulmonary artery cells pulmonary_artery confocal microscopy confocal microscopy immunostaining immunostaining Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch Accepted 2009-FEB-21 by DAVET. 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel Mol. Biol. Rep. (0301-4851) 2004 davet Only protein-protein interactions imex curation Caveolae: biochemical analysis. Caveolae: biochemical analysis. Mol. Biol. Rep. (0301-4851) 2004 imex curation Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel davet Only protein-protein interactions mouse-svec4-10 Mus musculus EC cels derived from lymph node stroma. svec4-10 mouse EC cell line derived from lymph node Transient SV40 infection of mouse EC derived from lymph node stroma has resulted in a cell line, SVEC4-10, that retains morphological and functional characteristics of normal EC. confocal microscopy confocal microscopy immunostaining immunostaining Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch Accepted 2009-FEB-21 by DAVET. 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel Mol. Biol. Rep. (0301-4851) 2004 davet Only protein-protein interactions imex curation Caveolae: biochemical analysis. Caveolae: biochemical analysis. Mol. Biol. Rep. (0301-4851) 2004 imex curation Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel davet Only protein-protein interactions rat-lung Rattus norvegicus lung Rat lung anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch Accepted 2009-FEB-21 by DAVET. 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel Mol. Biol. Rep. (0301-4851) 2004 davet Only protein-protein interactions imex curation Caveolae: biochemical analysis. Caveolae: biochemical analysis. Mol. Biol. Rep. (0301-4851) 2004 imex curation Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel davet Only protein-protein interactions rat-lung Rattus norvegicus lung Rat lung anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch Accepted 2009-FEB-21 by DAVET. 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel Mol. Biol. Rep. (0301-4851) 2004 davet Only protein-protein interactions imex curation Caveolae: biochemical analysis. Caveolae: biochemical analysis. Mol. Biol. Rep. (0301-4851) 2004 imex curation Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel davet Only protein-protein interactions bovin-pulmonary_artery Bos taurus pulmonary artery cells pulmonary_artery light microscopy light microscopy immunostaining immunostaining Chatenay-Rivauday C., Cakar ZP., Jeno P., Kuzmenko ES., Fiedler K. needs to be completed Membranes P1 fraction of isolate from perfused rat lungs were extracted, immuno-precipitated with anti alpha-cav1 and separated on gels. Gels were subjected to western blotting. contact@klausfiedler.ch Accepted 2009-FEB-21 by DAVET. 09-April-2009: Contacted by JYOTI. 17-Dec-2008: Klaus Fiedler, Biozentrum, University of Basel Mol. Biol. Rep. (0301-4851) 2004 davet Only protein-protein interactions imex curation flot2_rat Flotillin-2 Flot2 Reg1 Reggie-1 protein protein rat Rattus norvegicus (Rat) Rat MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV E482A0E2071D3CA7 q58cz4_bovin Flotillin FLOT2 protein protein bovin Bos taurus (Bovine) Bovine MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKSVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRCPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEARGKAEAELLIY 3A66186C10E53595 actb_rat Actin, cytoplasmic 1 Actb Beta-actin protein protein rat Rattus norvegicus (Rat) Rat MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 6AFD05CA94E360E2 p49817-1 Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI CF88FE9B1D3D67AE cav2_rat Caveolin-2 Cav2 protein protein rat Rattus norvegicus (Rat) Rat MGLETEKADVQLFMADDAYSHHSVVDYTDPEKYVDSSQDRDPHQLNSHLKLGFEDLIAEPPTTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVVIGPLCTSVGRIFSSVSMQLSHD 7F8423C6B42F2F55 p41350-2 Caveolin-1 Cav1 Cav protein protein rat Rattus norvegicus (Rat) Rat MADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI 6BB1A8538BC34440 actb_mouse Actin, cytoplasmic 1 Actb Beta-actin protein protein mouse Mus musculus Mouse MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 6AFD05CA94E360E2 p41350-1 Caveolin-1 Cav1 Cav protein protein rat Rattus norvegicus (Rat) Rat MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI 55E8F6ABC7514FD2 nb5r3_rat NADH-cytochrome b5 reductase 3 Cyb5r3 Dia1 Diaphorase-1 protein protein rat Rattus norvegicus (Rat) Rat MGAQLSTLSRVVLSPVWFVYSLFMKLFQRSSPAITLENPDIKYPLRLIDKEIISHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF 45431A644413905F cav1_bovin Caveolin-1 CAV1 protein protein bovin Bos taurus (Bovine) Bovine MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRINTQKEI 1A67CE55E301A3BF cav1-cav1 4 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 1f Caveolin-1 α and β were the major proteins in addition to the 50 kDa band. cav1-cav1-2 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1g, 1h cav1-flotillin_2 1 15 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Consistently, confocal sections demonstrated a punctate distribution of caveolin-1 in calf pulmonary artery, large vessel endothelial (CPAE) cells (Figure 1i, k) coinciding with ESA/reggie-1/flotillin- 2 positive structures (Figure 1j, l). 1i-l cav1-actin 2 12 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization We find that actin localized at caveolae in microvascular SVEC4-10 mouse endothelial cells as analyzed by confocal immunofluorescence microscopy (Figure 2a-d). 2a-d cav1-cav2 3 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region omega-n-glucosyl-l-arginine omega-N-glucosyl-L-arginine (2S)-2-amino-5-(beta-D-glucopyranosyl[imino(methylamino)methyl]amino)pentanoic acid NG-beta-D-glucosylarginine omega-N-(beta-D-glucosyl)-L-arginine omega-N-glucosyl-L-arginine omega-N-glycosyl-L-arginine Hex Hexose CARBOHYD N-linked (Glc) arginine certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region omega-n-glucosyl-l-arginine omega-N-glucosyl-L-arginine (2S)-2-amino-5-(beta-D-glucopyranosyl[imino(methylamino)methyl]amino)pentanoic acid NG-beta-D-glucosylarginine omega-N-(beta-D-glucosyl)-L-arginine omega-N-glucosyl-L-arginine omega-N-glycosyl-L-arginine Hex Hexose CARBOHYD N-linked (Glc) arginine certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain physical association physical association 4 cav1-actin-1 1 8 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization 2i-l In the presence of Jasplakinolide aggregates containing bundles were formed. This was visualized by conventional (Figure 2e-h) and confocal microscopy (Figure 2g-l). Actin bundles (Figure 2h, l) were proximal to caveolae and triggered their accumulation (Figure 2g,k) at or within these cortical areas. cav1-actin-2 5 15 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 2e-h In the presence of Jasplakinolide aggregates containing bundles were formed. This was visualized by conventional (Figure 2e-h) and confocal microscopy (Figure 2g-l). Actin bundles (Figure 2h, l) were proximal to caveolae and triggered their accumulation (Figure 2g,k) at or within these cortical areas.