IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heterodimeric interactions among the 1-amino-cyclopropane-1-carboxylate synthase polypeptides encoded by the Arabidopsis gene family. Heterodimeric interactions among the 1-amino-cyclopropane-1-carboxylate synthase polypeptides encoded by the Arabidopsis gene family. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Tsuchisaka A., Theologis A. theo@nature.berkeley.edu 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tsuchisaka A., Theologis A. theo@nature.berkeley.edu Accepted 2009-OCT-18 by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 jyoti Only protein-protein interactions imex curation Heterodimeric interactions among the 1-amino-cyclopropane-1-carboxylate synthase polypeptides encoded by the Arabidopsis gene family. Heterodimeric interactions among the 1-amino-cyclopropane-1-carboxylate synthase polypeptides encoded by the Arabidopsis gene family. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Tsuchisaka A., Theologis A. theo@nature.berkeley.edu 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions ecoli Escherichia coli (strain K12) bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Tsuchisaka A., Theologis A. Source organism of the control proteins was not provided and the interaction was not curated since the proteins could not be unambiguously identified. theo@nature.berkeley.edu Accepted 2009-OCT-18 by JYOTI. 27-Oct-2007: Contacted by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 jyoti Only protein-protein interactions imex curation 1a16_arath 1-aminocyclopropane-1-carboxylate synthase 6 ACS6 ACC6 S-adenosyl-L-methionine methylthioadenosine-lyase 6 F8L21.70 At4g11280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAFATEKKQDLNLLSKIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLKHPEASICTSEGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDRIVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKITVEALEAAYENARKSNIPVKGLLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATTFGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGLRVGIVYSYNDRVVQIARKMSSFGLVSSQTQHLIAKMLSDEEFVDEFIRESKLRLAARHAEITTGLDGLGIGWLKAKAGLFLWMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETALERIRVFTSQLEEETKPMAATTMMAKKKKKCWQSNLRLSFSDTRRFDDGFFSPHSPVPPSPLVRAQT 7FA94D3EABBCB4AB 1a14_arath 1-aminocyclopropane-1-carboxylate synthase 4 ACS4 ACC4 S-adenosyl-L-methionine methylthioadenosine-lyase 4 T20K9.2 At2g22810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVQLSRKATCNSHGQVSSYFLGWEEYEKNPYDVTKNPQGIIQMGLAENQLCFDLLESWLAQNTDAACFKRDGQSVFRELALFQDYHGLSSFKNAFADFMSENRGNRVSFDSNNLVLTAGATSANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGVEIVPIQSSSTNGFRITKLALEEAYEQAKKLDLNVKGILITNPSNPLGTTTTQTELNILFDFITKNKNIHLVSDEIYSGTVFNSSEFISVMEILKNNQLENTDVLNRVHIVCSLSKDLGLPGFRVGAIYSNDKDVISAATKMSSFGLVSSQTQYLLSSLLSDKKFTKNYLRENQKRLKNRQRKLVLGLEAIGIKCLKSNAGLFCWVDMRPLLRSKTFEAEMDLWKKIVYEVKLNISPGSSCHCEEPGWFRVCFANMIDETLKLALKRLKMLVDDENSSRRCQKSKSERLNGSRKKTMSNVSNWVFRLSFHDREAEER 98FD27622EAF3C21 1a11_arath 1-aminocyclopropane-1-carboxylate synthase-like protein 1 F2A19.110 At3g61510 ACS1 ACC2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSQGACENQLLSKLALSDKHGEASPYFHGWKAYDNNPFHPTHNPQGVIQMGLAENQLCSDLIKEWIKENPQASICTAEGIDSFSDIAVFQDYHGLKQFRQAIATFMERARGGRVRFEAERVVMSGGATGANETIMFCLADPGDAFLVPTPYYAAFDRDLRWRTGVRIIPVECSSSNNFQITKQALESAYLKAQETGIKIKGLIISNPLGTSLDRETLESLVSFINDKQIHLVCDEIYAATVFAEPGFISVAEIIQEMYYVNRDLIHIVYSLSKDMGLPGFRVGVVYSYNDVVVSCARRMSSFGLVSSQTQSFLAAMLSDQSFVDNFLVEVSKRVAKRHHMFTEGLEEMGISCLRSNAGLFVLMDLRHMLKDQTFDSEMALWRVIINKVKINVSPGSSFHCSEPGWFRVCFANMDEDTLQIALERIKDFVVGDRANKNKNCNCICNNKRENKKRKSFQKNLKLSLSSMRYEEHVRSPKLMSPHSPLLRA 411E049B993DEEE1 1a18_arath 1-aminocyclopropane-1-carboxylate synthase 8 ACS8 S-adenosyl-L-methionine methylthioadenosine-lyase 8 T28I19.50 At4g37770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLLSKKASCNTHGQDSSYFWGWEEYEKNPYDEIKNPDGIIQMGLAENQLSFDLIESWLAKNPDAANFQREGQSIFRELALFQDYHGLPSFKNAMADFMSENRGNRVSFNPNKLVLTAGATPANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGAEIVPIQCKSANGFRITKVALEEAYEQAQKLNLKVKGVLITNPSNPLGTTTTRTELNHLLDFISRKKIHLISDEIYSGTVFTNPGFISVMEVLKDRKLENTDVFDRVHIVYSLSKDLGLPGFRVGVIYSNDDFVVSAATKMSSFGLISSQTQYLLSALLSDKTFTKNYLEENQIRLKNRHKKLVSGLEAAGIECLKSNAGLFCWVDMRHLLKSNTFEAEIELWKKIVYEVKLNISPGSSCHCNEPGWFRVCFANLSEETLKVALDRLKRFVDGPSPTRRSQSEHQRLKNLRKMKVSNWVFRLSFHDREPEER 7BB3CE13E87BDDCE 1a17_arath 1-aminocyclopropane-1-carboxylate synthase 7 ACS7 S-adenosyl-L-methionine methylthioadenosine-lyase 7 T25K17.10 At4g26200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLPLMMERSSNNNNVELSRVAVSDTHGEDSPYFAGWKAYDENPYDESHNPSGVIQMGLAENQVSFDLLETYLEKKNPEGSMWGSKGAPGFRENALFQDYHGLKTFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDSSNHFQITPEALESAYQTARDANIRVRGVLITNPSNPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFTSVAEIVENIDDVSVKERVHIVYSLSKDLGLPGFRVGTIYSYNDNVVRTARRMSSFTLVSSQTQHMLASMLSDEEFTEKYIRINRERLRRRYDTIVEGLKKAGIECLKGNAGLFCWMNLGFLLEKKTKDGELQLWDVILKELNLNISPGSSCHCSEVGWFRVCFANMSENTLEIALKRIHEFMDRRRRF E78CC1FC834FD4A9 acs4 1 4 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:41:58 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:42:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3B Figure 3C Figure 3D Fig. 3B, compare lane 7, an inactive heterodimer, with lanes 5 and 6, which represent the active homodimers of ACS4 and ACS6, respectively acs6-acs4 1 4 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:41:40 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:41:46 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3B The results indicate the ACS4/ACS6 heterodimer is formed and its inactivity is not due to the absence of protein�protein interaction between the ACS4 and ACS6 mutant polypeptides acs6-1 1 3 unspecified role unspecified role prey prey undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:42:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys92ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:41:48 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3B Figure 3E acs8-acs4 1 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:05 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:42:12 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3C The results indicate the ACS4/ACS6 heterodimer is formed and its inactivity is not due to the absence of protein�protein interaction between the ACS4 and ACS6 mutant polypeptides acs8-1 1 6 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:39:52 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:39:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3C acs7-acs4 1 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:20 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:39:55 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3D ACS4 and ACS7 subunits independent of their enzyme activity (Fig. 3D, compare lane 7, which represents the inactive heterodimer, with lane 8, which represents the active heterodimer. Lanes 5 and 6 show the interaction of the ACS4 and ACS7 homodimers. acs4-acs7 1 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:27 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:23 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3D acs7-1 1 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3D acs1-1 1 5 unspecified role unspecified role prey prey undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:30:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys92ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:30:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3E the assay was used to test the interaction between the wt ACS1 and the K278A and Y92A mutants of ACS6 which give rise to two heterodimers, acs6-acs1 1 3 unspecified role unspecified role prey prey undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys92ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:13 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' ecoli Escherichia coli (strain K12) physical association physical association Figure 3E he results of Fig. 3E show that in both heterodimers, wt ACS1/ACS6 K278 (lane 7, inactive) and wt ACS1/ACS6 Y92A (lane 8, active), physical interaction occurs between the two polypeptides. Similar interaction is observed with the inactive wt ACS1 (Fig. 3E, lane 5) and active ACS6 homodimers acs6-2 2 3 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4B BiFC analysis demonstrating the formation of bJun/bFos heterodimer (positive control; ref. 24) and ACS6 homodimer. acs6-acs4-1 2 4 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' 3 unspecified role unspecified role neutral component neutral component undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:04 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5A Fig. 5 shows that the strain expressing the inactive ACS4/ACS6 heterodimer emits fluorescence, indicating that the ACS4 and ACS6 subunits interact acs4-1 2 4 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:33 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' 4 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:30 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' physical association physical association Figure 5A Figure 5F SFigure 8 acs6-2 2 3 unspecified role unspecified role neutral component neutral component undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:35 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' n-terminal C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:36 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys92ala' n-terminal N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 5A acs8-acs4-1 2 6 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:27 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' 4 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:22 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' physical association physical association Figure 5F A similar experiment was carried out with the active ACS4/ACS8 heterodimer and the results are shown in Fig. 5 E�H. The E. coli strain that expresses the active heterodimer and the active ACS4 and ACS8 homodimers emits fluorescence indicative of protein�protein interactions between the heterologous and homologous subunits acs8-2 2 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:38 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' 6 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:37 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' physical association physical association Figure 5F acs7-2 2 7 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' 7 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:09 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' physical association physical association SFigure 8 acs7-acs4-1 2 4 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' 7 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' physical association physical association SFigure 8 acs4-acs7-1 2 7 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:27:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr92ala' 4 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:04 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys278ala' physical association physical association SFigure 8