MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Directed discovery of bivalent peptide ligands to an SH3 domain. Directed discovery of bivalent peptide ligands to an SH3 domain. Protein Sci. (0961-8368) 2004 mimix curation Ferguson MR., Fan X., Mukherjee M., Luo J., Khan R., Ferreon JC., Hilser VJ., Shope RE., Fox RO. SH3 suggested by mcarducci mimix curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Ferguson MR., Fan X., Mukherjee M., Luo J., Khan R., Ferreon JC., Hilser VJ., Shope RE., Fox RO. SH3 suggested by mcarducci Protein Sci. (0961-8368) 2004 mimix curation mimix curation Directed discovery of bivalent peptide ligands to an SH3 domain. Directed discovery of bivalent peptide ligands to an SH3 domain. Protein Sci. (0961-8368) 2004 mimix curation Ferguson MR., Fan X., Mukherjee M., Luo J., Khan R., Ferreon JC., Hilser VJ., Shope RE., Fox RO. SH3 suggested by mcarducci mimix curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Ferguson MR., Fan X., Mukherjee M., Luo J., Khan R., Ferreon JC., Hilser VJ., Shope RE., Fox RO. SH3 suggested by mcarducci Protein Sci. (0961-8368) 2004 mimix curation mimix curation sem5_caeel Sex muscle abnormal protein 5 sem-5 C14F5.5 protein protein caeel Caenorhabditis elegans MEAVAEHDFQAGSPDELSFKRGNTLKVLNKDEDPHWYKAELDGNEGFIPSNYIRMTECNWYLGKITRNDAEVLLKKPTVRDGHFLVRQCESSPGEFSISVRFQDSVQHFKVLRDQNGKYYLWAVKFNSLNELVAYHRTASVSRTHTILLSDMNVETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSNKSNSNVAPGFNFGN 2D684C9520646C41 g4-l GGGGCLYTRY peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GGGGCLYTRYWCGRK mint 990726A66FA7888A sos1_mouse Son of sevenless homolog 1 Sos1 protein protein mouse Mus musculus Mouse MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPAERIHHLLREVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSSNDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHGHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTVLQEEKEEQMRLPSAEVYRFAEPDSEENILFEENVQPKAGIPIIKAGTVLKLIERLTYHMYADPNFVRTFLTTYRSFCRPQELLSLLIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLRRHGKELINFSKRRRVAEITGEIQQYQNQPYCLRVEPDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRHPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGTSSNTDVCSVFDSDHSASPFHSRSASVSSISLSKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEMDLHSIAGPPVPPRQSTSQLIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS 3286088A5BA0A4A6 3286088A5BA0A4A6 l CLYTRYWCGR peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) CLYTRYWCGRK mint 990726F1A36B4411 pp-g4-l PPPVPPRGGG peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PPPVPPRGGGGCLYTRYWCGRK mint 3FE7227D4FA7E3CD pp-g3-l PPPVPPRGGG peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PPPVPPRGGGCLYTRYWCGRK mint E903FD866FCC98CE sem_5-sos1 2 mSOS 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 homomint domino mint pp_g4_l-sem_5 2 PP-G4-L 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 domino mint pp_g3_l-sem_5 2 PP-G3-L 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 domino mint g4_l-sem_5 2 G4-L 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 domino mint l-sem_5 2 L 6 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 domino mint pp_g4_l-sem_5-1 1 PP-G4-L 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction domino mint f1 f2b f3c sem_5-sos1-1 1 mSOS 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint f2a f3a l-sem_5-1 1 L 6 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component SEM-5 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2c domino mint