IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Drosophila PAR-1 and 14-3-3 inhibit Bazooka/PAR-3 to establish complementary cortical domains in polarized cells. Drosophila PAR-1 and 14-3-3 inhibit Bazooka/PAR-3 to establish complementary cortical domains in polarized cells. Cell (0092-8674) 2003 imex curation Benton R., St Johnston D. A Beta-Galactosidase activity was used to determine the intensity of interactions. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. ds139@mole.bio.cam.ac.uk 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid polyclonal western polyclonal antibody western blot polyclonal western Benton R., St Johnston D. A Beta-Galactosidase activity was used to determine the intensity of interactions. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. ds139@mole.bio.cam.ac.uk Accepted 2010-FEB-5 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2003 orchard Only protein-protein interactions imex curation Drosophila PAR-1 and 14-3-3 inhibit Bazooka/PAR-3 to establish complementary cortical domains in polarized cells. Drosophila PAR-1 and 14-3-3 inhibit Bazooka/PAR-3 to establish complementary cortical domains in polarized cells. Cell (0092-8674) 2003 imex curation Benton R., St Johnston D. A Beta-Galactosidase activity was used to determine the intensity of interactions. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. ds139@mole.bio.cam.ac.uk 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Benton R., St Johnston D. A Beta-Galactosidase activity was used to determine the intensity of interactions. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. ds139@mole.bio.cam.ac.uk Accepted 2010-FEB-5 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2003 orchard Only protein-protein interactions imex curation Drosophila PAR-1 and 14-3-3 inhibit Bazooka/PAR-3 to establish complementary cortical domains in polarized cells. Drosophila PAR-1 and 14-3-3 inhibit Bazooka/PAR-3 to establish complementary cortical domains in polarized cells. Cell (0092-8674) 2003 imex curation Benton R., St Johnston D. A Beta-Galactosidase activity was used to determine the intensity of interactions. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. ds139@mole.bio.cam.ac.uk 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Benton R., St Johnston D. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. A Beta-Galactosidase activity was used to determine the intensity of interactions. baz-par interactions cannot be curated since many distinct variants of par-1 present in uniprot records. ds139@mole.bio.cam.ac.uk Accepted 2010-FEB-5 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2003 orchard Only protein-protein interactions imex curation 1433z_drome 14-3-3 protein zeta 14-3-3zeta 14-3-3EZ leo 14-3-3 THAP CG17870 14-3-3-like protein Protein Leonardo protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN C645CF3B10C6701A q9vx75_drome CG5055 baz CG5055-RA BAZ Baz Bazooka D-Par3 D-par3 Dmel\CG5055 PAR-3 PAR3 Par-3 Par3 dPar-3 l(1)G0484 par-3 par3 Dmel_CG5055 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKVTVCFGDVRILVPCGSGELLVRDLVKEATRRYIKAAGKPDSWVTVTHLQTQSGILDPDDCVRDVADDREQILAHFDDPGPDPGVPQGGGDGASGSSSVGTGSPDIFRDPTNTEAPTCPRDLSTPHIEVTSTTSGPMAGLGVGLMVRRSSDPNLLASLKAEGSNKRWSAAAPHYAGGDSPERLFLDKAGGQLSPQWEEDDDPSHQLKEQLLHQQQPHAANGGSSSGNHQPFARSGRLSMQFLGDGNGYKWMEAAEKLQNQPPAQQTYQQGSHHAGHGQNGAYSSKSLPRESKRKEPLGQAYESIREKDGEMLLIINEYGSPLGLTALPDKEHGGGLLVQHVEPGSRAERGRLRRDDRILEINGIKLIGLTESQVQEQLRRALESSELRVRVLRGDRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNGLGFSVTTRDNPAGGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEKSAGVAVAPSVAPPAVPAAAAPAPPIPVQKSSSARSLFTHQQQSQLNESQHFIDAGSESAASNDSLPPSSNSWHSREELTLHIPVHDTEKAGLGVSVKGKTCSNLNASGSSASSGSNGLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQNNAEAMETLRRAMVNTPGKHPGTITLLVGRKILRSASSSDILDHSNSHSHSHSNSSGGSNSNGSGNNNNSSSNASDNSGATVIYLSPEKREQRCNGGGGGGSAGNEMNRWSNPVLDRLTGGICSSNSAQPSSQQSHQQQPHPSQQQQQQRRLPAAPVCSSAALRNESYYMATNDNWSPAQMHLMTAHGNTALLIEDDAEPMSPTLPARPHDGQHCNTSSANPSQNLAVGNQGPPINTVPGTPSTSSNFDATYSSQLSLETNSGVEHFSRDALGRRSISEKHHAALDARETGTYQRNKKLREERERERRIQLTKSAVYGGSIESLTARIASANAQFSGYKHAKTASSIEQRETQQQLAAAEAEARDQLGDLGPSLGMKKSSSLESLQTMVQELQMSDEPRGHQALRAPRGRGREDSLRAAVVSEPDASKPRKTWLLEDGDHEGGFASQRNGPFQSSLNDGKHGCKSSRAKKPSILRGIGHMFRFGKNRKDGVVPVDNYAVNISPPTSVVSTATSPQLQQQQQQQLQQHQQQQQIPTAALAALERNGKPPAYQPPPPLPAPNGVGSNGIHQNDIFNHRYQHYANYEDLHQQHQQHQISRRHQHYHSQRSARSQDVSMHSTSSGSQPGSLAQPQAQSNGVRPMSSYYEYETVQQQRVGSIKHSHSSSATSSSSSPINVPHWKAAAMNGYSPASLNSSARSRGPFVTQVTIREQSSGGIPAHLLQQHQQQQLQQQQPTYQTVQKMSGPSQYGSAAGSQPHASKV 089B43434CA818C3 1433e_drome 14-3-3 protein epsilon 14-3-3epsilon 14-3-3e SR3-9 Suppressor of Ras1 3-9 CG31196 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVEDQDVS ProteinUpdateMessage : this protein should be deleted as it is not reflecting what is not in UniprotKB and is not involved in any interactions. 2C1562208547DA9C 14331_caeel 14-3-3-like protein 1 par-5 ftt-1 M117.2 Partitioning defective protein 5 protein protein caeel Caenorhabditis elegans MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN ABBE0DA27D9341AF par3_caeel Partitioning defective protein 3 par-3 F54E7.3 Abnormal embryonic partitioning of cytoplasm protein 3 protein protein caeel Caenorhabditis elegans MSASSTSSSSTSCPEGGEPSGSCKSSDEGESTLKKRMQQYGIASGYANSSISTLDRSQYQSLPLNGTRRVTVQFGRMKIVVPWKESDQTVGQLADAALLRYKKARGMANEDRIHVHRLECASDGGILDMDDVLEEVFDLNYDQILAITDEANGGSTTPTYSQIQKQQHHYAQPLPYARKFDGGPSTPIASAFGSVTVNHQAHRAASPYNVGFARSNSRDFAPQPTHSKERRDSVVEVSSFDQIPQSGLRVSTPKPSRQSEDVIDGKPMNQPILRSSLRTEASGSRTEEATPVKQSRVTLSPEVEKKLAEQDERKSERRKHYDKNPGRFARGSDRKSRITDALLDARDRIADQLESQNPAEETKSQMIRVKIDQGPMPGTSLVTFPPIPEKSENEKQLGIEVNAVFDESSELPGTSEPTKLSSVQIMKIEDGGRIAKDGRIRVGDCIVAIDGKPVDQMSIIRVRASISDLAAVTSRPVTLIINRSLESFLEQESSAKPIQSALQQANTQYIGHTTVVELIKSSNGFGFTVTGRETAKGERLFYIGTVKPYGVALGHLKSGDRLLEINGTPTGQWTQSEIVEKLKETMVGEKIKFLVSRVSQSAIMSTSASSENKENEETLKVVEEEKIPQKLPLPALMTPPVPKDTPALSPSGASRFEIVIPFINGSSSAGLGVSLKARVSKKSNGSKVDCGIFIKNVMHGGAAFKEGGLRVDDRIVGVEDIDLEPLDNREAQAALAKKLKEVGMISSNVRLTISRYNECNPGQISRDLSRITVDASSPSPSSRMSSHTAPDSLLPSPATRGTSSSGADSSHSRQSSASSAVPAVPARLTERDSIVSDGTSRNDESELPDSADPFNREGLGRKSLSEKRGMGAAADPQHIKLFQDIKHQRQNSAPTSSTQKRSKSQPRSSSQRNYRSPMKLVDLPTTAAASASTNSQNLDDSDMLNRRSQSMESINRPVESILRGTGQIPTGSSSKVQFMQAASPDQHPFPPGAALLRLKNEESRSRDKSRRKSMGNPFSAMRNFFGFGSKSRDASPEKTPTESVQLRSVERPKSIIDERNNGSSERAPPPLPPHQSQRRGSGGNVFVDYGEPYGLIPQYPHNTTSGYESYADSELYDRYAAHRYHPRGGPIIDEDEYIYRQQSTSGNSPINTSSYVNYGLPASNAYHVGSRIPPQTSSGSISKTSGAMRRVYPAEYDEDVAYHQQIPQQSTRYQQGSGSGRGNADYHHMFNSWFAYTGGGAVGAAPVIKSSYGSSPVRIAAASAIERGESFVVEPVSGSSASATDRRGRSTSSGAVASGSSSTGFQYAAKEKYADARSGKFNGGSTRLFIPRHGGGLSAAAFATNFGGEAYETRGGGAGGSPSQYRRRDQGPPHRFPQY 3B498E7652CFF17D kpc1_drome Protein kinase C, brain isozyme dPKC53E(BR) Pkc53E PKC1 CG6622 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEGSDNNGDPQQQGAEGEAVGENKMKSRLRKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSDSPKTQHNFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLLKLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYVFSP 3C69AD351E36B7DC baz-leo 2 4 unspecified role unspecified role prey prey P29310:p.Glu183Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:55:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183lys' Tue Jun 30 19:48:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Lys' 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9VX75:p.Ser1085Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:07:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1085ala' Tue Jun 30 17:20:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1085Ala' Q9VX75:p.Ser1083Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:03:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1083ala' Tue Jun 30 16:47:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1083Ala' Q9VX75:p.Ser1084Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:57:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1084ala' Tue Jun 30 16:44:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1084Ala' physical association physical association 2A, B, C In a two-hybrid screen of candidate proteins with a known role in cell polarity, we detected a strong association between 14-3-3 and BAZ (Figure 2A). baz-1433e 2 6 unspecified role unspecified role prey prey P92177:p.Glu183Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:22:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183lys' Tue Jun 30 17:52:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Lys' 5 unspecified role unspecified role bait bait Q9VX75:p.Ser1085Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:57:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1085ala' Tue Jun 30 17:23:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1085Ala' Q9VX75:p.Ser1084Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:42:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1084ala' Tue Jun 30 17:03:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1084Ala' Q9VX75:p.Ser1083Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:51:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1083ala' Tue Jun 30 18:27:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1083Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A, B, C In a two-hybrid screen of candidate proteins with a known role in cell polarity, we detected a strong association between 14-3-3 and BAZ (Figure 2A). par3-par5 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait Q17353:p.Ser960Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:41:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser960ala' Tue Jun 30 19:44:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser960Ala' physical association physical association 2F, 2G C. elegans PAR-3 is more divergent, however, and we therefore used the two-hybrid assay to determine whether it associates with the C.elegans 14-3-3 homolog, PAR-5 baz-1433e-1 3 6 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey Q9VX75:p.[Ser151Ala;Ser1085Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 10:54:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1085ala,ser151ala' Wed May 02 18:47:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser151ala,ser1085ala' Tue Jun 30 17:18:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser151Ala;Ser1085Ala]' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 2E Furthermore, a mutant form of full-length BAZ, in which both of the predicted phosphoserine residues are mutated to alanine (BAZS151A,S1085A), fails to bind to MBP:14-3-3, indicating that these are the only 14-3-3 binding sites (Figure 2E). baz-1433e-2 1 5 inhibitor inhibitor ancillary ancillary 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association 6C,D Binding of 14-3-3epsilon to Ser-1085 of BAZ blocks the ability of aPKC to associate with BAZ. baz-pkc 1 6 inhibitor inhibitor ancillary ancillary 5 unspecified role unspecified role bait bait Q9VX75:p.Ser980Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:56:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser980ala' Tue Jun 30 20:14:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser980Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association 6B,A BAZ-C Ser980Ala,Ser1085Ala interacts with aPKC 30 times more strongly than BAZ-C Ser980Ala. baz-1433e-3 2 5 unspecified role unspecified role bait bait Q9VX75:p.Ser151Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:14:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser151ala' Tue Jun 30 19:17:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser151Ala' n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey P92177:p.Glu183Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 20:20:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183lys' Tue Jun 30 19:58:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Lys' physical association physical association 2A, B, C In a two-hybrid screen of candidate proteins with a known role in cell polarity, we detected a strong association between 14-3-3 and BAZ (Figure 2A). baz-leo-1 2 5 unspecified role unspecified role bait bait Q9VX75:p.Ser151Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:40:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser151ala' Tue Jun 30 17:39:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser151Ala' n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey P29310:p.Glu183Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:49:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183lys' Tue Jun 30 20:10:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Lys' physical association physical association 2A, B, C In a two-hybrid screen of candidate proteins with a known role in cell polarity, we detected a strong association between 14-3-3 and BAZ (Figure 2A). baz-pkc-1 2 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait Q9VX75:p.Ser1085Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:54:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1085ala' Tue Jun 30 16:30:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1085Ala' Q9VX75:p.Ser980Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:21:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser980ala' Tue Jun 30 19:37:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser980Ala' physical association physical association 6C BAZ-CS980A,S1085A interacts with aPKC 30 times more strongly than BAZ-CS980A, even in the absence of Drosophila 14-3-3 (Figure 6C).