IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional dissection of the zinc finger and flanking domains of the Yth1 cleavage/polyadenylation factor. Functional dissection of the zinc finger and flanking domains of the Yth1 cleavage/polyadenylation factor. Nucleic Acids Res. (0305-1048) 2003 imex curation Tacahashi Y., Helmling S., Moore CL. claire.moore@tufts.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tacahashi Y., Helmling S., Moore CL. claire.moore@tufts.edu Accepted 2009-OCT-18 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2003 Only protein-protein interactions imex curation Functional dissection of the zinc finger and flanking domains of the Yth1 cleavage/polyadenylation factor. Functional dissection of the zinc finger and flanking domains of the Yth1 cleavage/polyadenylation factor. Nucleic Acids Res. (0305-1048) 2003 imex curation Tacahashi Y., Helmling S., Moore CL. claire.moore@tufts.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Tacahashi Y., Helmling S., Moore CL. claire.moore@tufts.edu Accepted 2009-OCT-18 by ORCHARD. Nucleic Acids Res. (0305-1048) 2003 Only protein-protein interactions imex curation Functional dissection of the zinc finger and flanking domains of the Yth1 cleavage/polyadenylation factor. Functional dissection of the zinc finger and flanking domains of the Yth1 cleavage/polyadenylation factor. Nucleic Acids Res. (0305-1048) 2003 imex curation Tacahashi Y., Helmling S., Moore CL. claire.moore@tufts.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tacahashi Y., Helmling S., Moore CL. claire.moore@tufts.edu Accepted 2009-OCT-18 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2003 Only protein-protein interactions imex curation yth1_yeast mRNA 3'-end-processing protein YTH1 Yeast 30 kDa homolog 1 YTH1 YPR107C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLIHPDTAKYPFKFEPFLRQEYSFSLDPDRPICEFYNSREGPKSCPRGPLCPKKHVLPIFQNKIVCRHWLRGLCKKNDQCEYLHEYNLRKMPECVFFSKNGYCTQSPDCQYLHIDPASKIPKCENYEMGFCPLGSSCPRRHIKKVFCQRYMTGFCPLGKDECDMEHPQFIIPDEGSKLRIKRDDEINTRKMDEEKERRLNAIINGEV 79C5993AE4E670EA 79C5993AE4E670EA fip1_yeast Pre-mRNA polyadenylation factor FIP1 J1911 YJR093C FIP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSEDEDDKFLYGSDSELALPSSKRSRDDEADAGASSNPDIVKRQKFDSPVEETPATARDDRSDEDIYSDSSDDDSDSDLEVIISLGPDPTRLDAKLLDSYSTAATSSSKDVISVATDVSNTITKTSDERLITEGEANQGVTATTVKATESDGNVPKAMTGSIDLDKEGIFDSVGITTIDPEVLKEKPWRQPGANLSDYFNYGFNEFTWMEYLHRQEKLQQDYNPRRILMGLLSLQQQGKLNSANDTDSNLGNIIDNNNNVNNANMSNLNSNMGNSMSGTPNPPAPPMHPSFPPLPMFGSFPPFPMPGMMPPMNQQPNQNQNQNSK 471CA2B0CDF99D0A 471CA2B0CDF99D0A ysh1_yeast Endoribonuclease YSH1 YSH1 BRR5 Yeast 73 kDa homolog 1 YLR277C mRNA 3'-end-processing protein YSH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERTNTTTFKFFSLGGSNEVGRSCHILQYKGKTVMLDAGIHPAYQGLASLPFYDEFDLSKVDILLISHFHLDHAASLPYVMQRTNFQGRVFMTHPTKAIYRWLLRDFVRVTSIGSSSSSMGTKDEGLFSDEDLVDSFDKIETVDYHSTVDVNGIKFTAFHAGHVLGAAMFQIEIAGLRVLFTGDYSREVDRHLNSAEVPPLSSNVLIVESTFGTATHEPRLNRERKLTQLIHSTVMRGGRVLLPVFALGRAQEIMLILDEYWSQHADELGGGQVPIFYASNLAKKCMSVFQTYVNMMNDDIRKKFRDSQTNPFIFKNISYLRNLEDFQDFGPSVMLASPGMLQSGLSRDLLERWCPEDKNLVLITGYSIEGTMAKFIMLEPDTIPSINNPEITIPRRCQVEEISFAAHVDFQENLEFIEKISAPNIILVHGEANPMGRLKSALLSNFASLKGTDNEVHVFNPRNCVEVDLEFQGVKVAKAVGNIVNEIYKEENVEIKEEIAAKIEPIKEENEDNLDSQAEKGLVDEEEHKDIVVSGILVSDDKNFELDFLSLSDLREHHPDLSTTILRERQSVRVNCKKELIYWHILQMFGEAEVLQDDDRVTNQEPKVKEESKDNLTNTGKLILQIMGDIKLTIVNTLAVVEWTQDLMNDTVADSIIAILMNVDSAPASVKLSSHSCDDHDHNNVQSNAQGKIDEVERVKQISRLFKEQFGDCFTLFLNKDEYASNKEETITGVVTIGKSTAKIDFNNMKILECNSNPLKGRVESLLNIGGNLVTPLC 901582F0C33AD6F7 901582F0C33AD6F7 yth1-fip1-2 2 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 5 Interactions of yth1 mutants with Fip1. (A) Co-immunoprecipitation of His6-Fip1 and recombinant Yth1 deletions using anti-His5 antibody. yth1-brr5 3 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 6 GST-fused Yth1 deletions were tested by a GST pull-down assay with His6- and HA-tagged Brr5 using glutathione-Sepharose beads. The wild-type and all of the truncations tested were able to pull down His6-Brr5-HA3, but GST-yth1(57-208)N2 and GST-yth1(1-118/147-208)ZF4 exhibited a weaker interaction. Thus, ZF4 and the N-terminus including ZF1 both contribute to efficient binding of Brr5. yth1-fip1-3 1 4 unspecified role unspecified role prey prey Q06102:p.Gly130Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G R Wed May 02 18:03:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly130arg' Tue Jun 30 16:24:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly130Arg' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction Figure 5c Co-immunoprecipitation of His6-Fip1 and in vitro translated 35S-labeled Yth1 and yth1G130R using anti-His5 antibody. Lanes 5 and 6 show in vitro translated proteins corresponding to 5% of the input used for immunoprecipitation.