IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. J. Biol. Chem. (0021-9258) 2002 imex curation Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors state that the experiment does not exclude the possibility that the 220-230 kDa band may represent p75NTR trimerized by an autocrine/paracrine neurotrophic ligand, and/or that the high molecular mass band represents a complex containing another protein not detected by the anti-p75NTR antibody. Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu Accepted 2007-FEB-26 by ORCHARD. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. J. Biol. Chem. (0021-9258) 2002 imex curation Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Apoptosis - Interactions involving proteins with a function related to apoptosis Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu Accepted 2007-FEB-26 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. J. Biol. Chem. (0021-9258) 2002 imex curation Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Apoptosis - Interactions involving proteins with a function related to apoptosis Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu Accepted 2007-FEB-26 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. Amyloid beta binds trimers as well as monomers of the 75-kDa neurotrophin receptor and activates receptor signaling. J. Biol. Chem. (0021-9258) 2002 imex curation Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Yaar M., Zhai S., Fine RE., Eisenhauer PB., Arble BL., Stewart KB., Gilchrest BA. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors state that the experiment does not exclude the possibility that the 220-230 kDa band may represent p75NTR trimerized by an autocrine/paracrine neurotrophic ligand, and/or that the high molecular mass band represents a complex containing another protein not detected by the anti-p75NTR antibody. Abeta binding to p75NTR induces c-Jun mRNA and activation of JNK. E17 fetal rat cortical neurons were stimulated with aggregated 125I-Abeta and immunoprecipated with anti rat-p75NTR antibodies. Immunoprecipitates were seperated by 8% PAGE and exposed to autoradiography. bgilchre@bu.edu Accepted 2007-FEB-26 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV DIP protein P07174 original sequence version: 124 DIP protein P07174 original sequence version: 106 B2E152D94D3827F8 tnr16_human Tumor necrosis factor receptor superfamily member 16 NGFR TNFRSF16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein human Homo sapiens Human MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSESTATSPV DIP protein P08138 original sequence version: 143 B09FA143FB3D625B p05067-pro_0000000093 Amyloid-beta protein 40 APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 672 711 D563D7858C3768F1 ngfr-p05067pro 3 5 unspecified role unspecified role bait bait rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell 7 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b ngfr-p05067pro-3 3 5 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 7 unspecified role unspecified role prey prey iodine-125 isotope label isotope label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2a ngfr-p05067pro-2 2 6 unspecified role unspecified role bait bait mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 7 unspecified role unspecified role prey prey iodine-125 isotope label isotope label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b Species source of the p75NTR sequence transfected into NIH 3T3 cell is not described. However it was confirmed to be the human sequence following correspondence with the author. Abeta 1-40 sequence was also confirmed to be human in origin. P08138 transfection ngfr-p05067pro-1 2 6 unspecified role unspecified role bait bait mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 7 unspecified role unspecified role prey prey iodine-125 isotope label isotope label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Species source of the p75NTR sequence transfected into NIH 3T3 cell is not described. However it was confirmed to be the human sequence following correspondence with the author. Abeta 1-40 sequence was also confirmed to be human in origin. 2a Abeta is shown to bind to p75NTR trimers however the number of Abeta molecules binding to each trimer is undetermined. P08138 transfection ngfr-1 1 5 unspecified role unspecified role neutral component neutral component physical association physical association 1a ngfr 4 6 unspecified role unspecified role neutral component neutral component physical association physical association 1b and 1d Species source of the p75NTR sequence transfected into NIH 3T3 cell is not described. However it was confirmed to be the human sequence following correspondence with the author.