UniProt UniProt http://www.uniprot.org Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. J. Biol. Chem. (0021-9258) 2000 imex curation Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp Accepted 2009-FEB-28 by DAVET. 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. J. Biol. Chem. (0021-9258) 2000 davet Only protein-protein interactions imex curation Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. J. Biol. Chem. (0021-9258) 2000 imex curation Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. davet Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp Accepted 2009-FEB-28 by DAVET. 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. J. Biol. Chem. (0021-9258) 2000 davet Only protein-protein interactions imex curation Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. J. Biol. Chem. (0021-9258) 2000 imex curation Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp Accepted 2009-FEB-28 by DAVET. 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. J. Biol. Chem. (0021-9258) 2000 davet Only protein-protein interactions imex curation Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. J. Biol. Chem. (0021-9258) 2000 imex curation Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. davet Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Inoue K., Mizuno T., Wada K., Hagiwara M. m.hagiwara.end@mri.tmd.ac.jp Accepted 2009-FEB-28 by DAVET. 09-April-2009: Contacted by JYOTI. A Yeast cDNA library was used. J. Biol. Chem. (0021-9258) 2000 davet Only protein-protein interactions imex curation dbp2_yeast ATP-dependent RNA helicase DBP2 DBP2 YNL112W N1945 DEAD box protein 2 p68-like protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MTYGGRDQQYNKTNYKSRGGDFRGGRNSDRNSYNDRPQGGNYRGGFGGRSNYNQPQELIKPNWDEELPKLPTFEKNFYVEHESVRDRSDSEIAQFRKENEMTISGHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGAKLISIMREANQNIPPELLKYDRRSYGGGHPRYGGGRGGRGGYGRRGGYGGGRGGYGGNRQRDGGWGNRGRSNY 30FE3D4C7E653120 30FE3D4C7E653120 air2_yeast Protein AIR2 Arginine methyltransferase-interacting RING finger protein 2 AIR2 YDL175C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR 5915C97FA39D6AFC 5915C97FA39D6AFC nsr1_yeast Nuclear localization sequence-binding protein NSR1 YGR159C G7001 p67 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKTTKVKGNKKEVKASKQAKEEKAKAVSSSSSESSSSSSSSSESESESESESESSSSSSSSDSESSSSSSSDSESEAETKKEESKDSSSSSSDSSSDEEEEEEKEETKKEESKESSSSDSSSSSSSDSESEKEESNDKKRKSEDAEEEEDEESSNKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRPNNDGGRGGSRGFGGRGGGRGGNRGFGGRGGARGGRGGFRPSGSGANTAPLGRSRNTASFAGSKKTFD 90DEEE7BBC20BC0C 90DEEE7BBC20BC0C nop3_yeast Nucleolar protein 3 MTR13 MTS1 Mitochondrial targeting suppressor 1 protein Nuclear polyadenylated RNA-binding protein 1 NPL3 NAB1 YDR432W D9461.19 NOP3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEAQETHVEQLPESVVDAPVEEQHQEPPQAPDAPQEPQVPQESAPQESAPQEPPAPQEQNDVPPPSNAPIYEGEESHSVQDYQEAHQHHQPPEPQPYYPPPPPGEHMHGRPPMHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVERDDNPPPIRRSNRGGFRGRGGFRGGFRGGFRGGFSRGGFGGPRGGFGGPRGGYGGYSRGGYGGYSRGGYGGSRGGYDSPRGGYDSPRGGYSRGGYGGPRNDYGPPRGSYGGSRGGYDGPRGDYGPPRDAYRTRDAPRERSPTR 024439E4B6578787 024439E4B6578787 gbp2_yeast Single-strand telomeric DNA-binding protein GBP2 GBP2 RLF6 YCL011C YCL11C RAP1 localization factor 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERELGMYGNDRSRSRSPVRRRLSDDRDRYDDYNDSSSNNGNGSRRQRRDRGSRFNDRYDQSYGGSRYHDDRNWPPRRGGRGRGGSRSFRGGRGGGRGRTLGPIVERDLERQFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKGHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARRD 5341D7A0E07F208C 5341D7A0E07F208C nab2_yeast Nuclear polyadenylated RNA-binding protein NAB2 YGL122C NAB2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIAQQQQQQQQQQQPDIAQQQPQQQPQQQPQQQPQQQPQQQPQQQPQQQPQQQPQLQPLQPQLGTQNAMQTDAPATPSPISAFSGVVNAAAPPQFAPVDNSQRFTQRGGGAVGKNRRGGRGGNRGGRNNNSTRFNPLAKALGMAGESNMNFTPTKKEGRCRLFPHCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEFLHPNEDEELMKEMERTREEFQKRKADLLAAKRKPVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQKKAAPPPVEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVLPEKKGAAPNSNVPTNERPFALPENAIIENAPPQTSFTHQEQDTEMN 40335C3D4658DD91 40335C3D4658DD91 air1_yeast Protein AIR1 Arginine methyltransferase-interacting RING finger protein 1 AIR1 YIL079C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTLLSEVESIDTLPYVKDTTPTGSDSSSFNKLLAPSIEDVDANPEELRTLRGQGRYFGITDYDSNGAIMEAEPKCNNCSQRGHLKRNCPHVICTYCGFMDDHYSQHCPKAIICTNCNANGHYKSQCPHKWKKVFCTLCNSKRHSRERCPSIWRSYLLKTKDANQGDFDFQTVFCYNCGNAGHFGDDCAERRSSRVPNTDGSAFCGDNLATKFKQHYFNQLKDYKREASQRQHFDNEHEFNLLDYEYNDDAYDLPGSRTYRDKMKWKGKVQSTRNKNSSNNRYESSNNRKKKSPFSAQNYKVTKNKRVQTHPLDFPRSSQNNRTNDYSSQFSYNRDDFPKGPKNKRGRSSSNKSQRNGRY 3CA920FA1204EC9C 3CA920FA1204EC9C hmt1_yeast Protein arginine N-methyltransferase 1 Major type I protein arginine N-methyltransferase HMT1 ODP1 RMT1 hnRNP arginine N-methyltransferase YBR0320 YBR034C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKTAVKDSATEKTKLSESEQHYFNSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLPFPKVDIIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLEDSQYKDEKLNYWQDVYGFDYSPFVPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDLAFKSNFKLTAKRQDMINGIVTWFDIVFPAPKGKRPVEFSTGPHAPYTHWKQTIFYFPDDLDAETGDTIEGELVCSPNEKNNRDLNIKISYKFESNGIDGNSRSRKNEGSYLMH 383AF61033FB4AC2 383AF61033FB4AC2 sub2_yeast ATP-dependent RNA helicase SUB2 SUB2 Suppressor of BRR1 protein 2 YDL084W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNNNTAAGDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN AB3605A8C38A560C AB3605A8C38A560C gar1_yeast H/ACA ribonucleoprotein complex subunit GAR1 YHR089C GAR1 snoRNP protein GAR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR C197FE85644DD0F8 C197FE85644DD0F8 rml2_yeast 54S ribosomal protein RML2, mitochondrial RML2 Mitochondrial large ribosomal subunit protein uL2m SYGP-ORF37 YEL050C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLVLGSLRSALSCSSTASLISKRNPCYPYGILCRTLSQSVKLWQENTSKDDSSLNITPRLLKIIPNDTDIVTLEKQDELIKRRRKLSKEVTQMKRLKPVSPGLRWYRSPIYPYLYKGRPVRALTVVRKKHGGRNNSGKITVRHQGGGHRNRTRLIDFNRWEGGAQTVQRIEYDPGRSSHIALLKHNTTGELSYIIACDGLRPGDVVESFRRGIPQTLLNEMGGKVDPAILSVKTTQRGNCLPISMIPIGTIIHNVGITPVGPGKFCRSAGTYARVLAKLPEKKKAIVRLQSGEHRYVSLEAVATIGVVSNIDHQNRSLGKAGRSRWLGIRPTVRGVAMNKCDHPHGGGRGKSKSNKLSMSPWGQLAKGYKTRRGKNQNRMKVKDRPRGKDARL 6AD955FF61C24923 6AD955FF61C24923 nop3-hmt1-1 1 12 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-air1-1 1 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-nab2-1 1 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-gbp2-1 1 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-gar1-1 1 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-dbp2-1 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-nsr1-1 1 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-sub2-1 1 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-rml2-2 1 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table III nop3-air1-2 3 12 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1B nop3-sub2-2 3 12 unspecified role unspecified role ancillary ancillary 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey physical association physical association Fig 1B nop3-hmt1-2 2 12 unspecified role unspecified role prey prey n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] physical association physical association Fig 2A hmt1-air1-1 2 12 unspecified role unspecified role bait bait n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain escherichia coli dh5[alpha] escherichia coli dh5[alpha] 11 unspecified role unspecified role prey prey n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 2A, 2C nop3-hmt1-3 4 8 enzyme target enzyme target substrate substrate neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] 12 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] methylation methylation reaction methylation Fig 3 Reaction is inhibited by T7-AIR1. nop3-air2-1 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role ancillary ancillary physical association physical association Fig 4B, 4C