IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. Plant J. (0960-7412) 2000 imex curation Kurup S., Jones HD., Holdsworth MJ. mike.holdsworth@bbsrc.ac.uk Arabidopsis seed and silique cDNA library jyoti Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kurup S., Jones HD., Holdsworth MJ. It was not possible to accurately identify wheatgerm polymerase cited in the paper. mike.holdsworth@bbsrc.ac.uk Accepted 2009-MAY-20 by JYOTI. Arabidopsis seed and silique cDNA library Plant J. (0960-7412) 2000 jyoti Only protein-protein interactions imex curation Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. Plant J. (0960-7412) 2000 imex curation Kurup S., Jones HD., Holdsworth MJ. mike.holdsworth@bbsrc.ac.uk Arabidopsis seed and silique cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kurup S., Jones HD., Holdsworth MJ. mike.holdsworth@bbsrc.ac.uk Accepted 2009-MAY-20 by JYOTI. Arabidopsis seed and silique cDNA library Plant J. (0960-7412) 2000 jyoti Only protein-protein interactions imex curation Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. Plant J. (0960-7412) 2000 imex curation Kurup S., Jones HD., Holdsworth MJ. mike.holdsworth@bbsrc.ac.uk Arabidopsis seed and silique cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kurup S., Jones HD., Holdsworth MJ. mike.holdsworth@bbsrc.ac.uk Accepted 2009-MAY-20 by JYOTI. Arabidopsis seed and silique cDNA library Plant J. (0960-7412) 2000 jyoti Only protein-protein interactions imex curation abi3_arath B3 domain-containing transcription factor ABI3 ABI3 MSD24.2 At3g24650 Protein ABSCISIC ACID-INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDLIVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQTNHLQRRRTTTTTTNLSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQQAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPPTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK D6A0F740D733060F pfd4_arath Probable prefoldin subunit 4 At1g08780 AIP3 ABI3-interacting protein 3 F22O13.27 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQQQGSKSGSEMEVTWEDQQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADEEMVRFQIGEVFAHVPRDDVETKIEEMKEATCKSLEKLEQEKESIVTQMAALKKVLYAKFKDSINLEED 1562DF409E43884A aprr1_arath Two-component response regulator-like APRR1 APRR1 AIP1 TOC1 At5g61380 MFB13.16 Pseudo-response regulator 1 Timing of CAB expression 1 ABI3-interacting protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLNGECKGGDGFIDRSRVRILLCDNDSTSLGEVFTLLSECSYQVTAVKSARQVIDALNAEGPDIDIILAEIDLPMAKGMKMLRYITRDKDLRRIPVIMMSRQDEVPVVVKCLKLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNMLSYDFDLVGSDQSDPNTNSTNLFSDDTDDRSLRSTNPQRGNLSHQENEWSVATAPVHARDGGLGADGTATSSLAVTAIEPPLDHLAGSHHEPMKRNSNPAQFSSAPKKSRLKIGESSAFFTYVKSTVLRTNGQDPPLVDGNGSLHLHRGLAEKFQVVASEGINNTKQARRATPKSTVLRTNGQDPPLVNGNGSHHLHRGAAEKFQVVASEGINNTKQAHRSRGTEQYHSQGETLQNGASYPHSLERSRTLPTSMESHGRNYQEGNMNIPQVAMNRSKDSSQVDGSGFSAPNAYPYYMHGVMNQVMMQSAAMMPQYGHQIPHCQPNHPNGMTGYPYYHHPMNTSLQHSQMSLQNGQMSMVHHSWSPAGNPPSNEVRVNKLDRREEALLKFRRKRNQRCFDKKIRYVNRKRLAERRPRVKGQFVRKMNGVNVDLNGQPDSADYDDEEEEEEEEEEENRDSSPQDDALGT DIP protein Q9LKL2 original sequence version: 103 EDBE0AA0B7FAB61E rpb5a_arath DNA-directed RNA polymerases II and IV subunit 5A NRPB5A DNA-directed RNA polymerase II subunit E NRPD5A RNA polymerase I, II and III 24.3 kDa subunit RPABC24.3 MCB17.4 MCB17_5 At3g22320 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLTEEELKRLYRIQKTLMQMLRDRGYFIADSELTMTKQQFIRKHGDNMKREDLVTLKAKRNDNSDQLYIFFPDEAKVGVKTMKMYTNRMKSENVFRAILVVQQNLTPFARTCISEISSKFHLEVFQEAEMLVNIKEHVLVPEHQVLTTEEKKTLLERYTVKETQLPRIQVTDPIARYFGLKRGQVVKIIRPSETAGRYVTYRYVV DIP protein O81098 original sequence version: 65 97933DEA098076C3 aip2_arath E3 ubiquitin-protein ligase AIP2 ABI3-interacting protein 2 AIP2 RING-type E3 ubiquitin transferase AIP2 F22D1.80 At5g20910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDASSSPSPSEESLKLELDDLQKQLNKKLRFEASVCSIHNLLRDHYSSSSPSLRKQFYIVVSRVATVLKTRYTATGFWVAGLSLFEEAERLVSDASEKKHLKSCVAQAKEQLSEVDNQPTESSQGYLFEGHLTVDREPPQPQWLVQQNLMSAFASIVGGESSNGPTENTIGETANLMQELINGLDMIIPDILDDGGPPRAPPASKEVVEKLPVIIFTEELLKKFGAEAECCICKENLVIGDKMQELPCKHTFHPPCLKPWLDEHNSCPICRHELPTDDQKYENWKEREKEAEEERKGAENAVRGGEYMYV 47D3C96AF08D034E cons_arath Zinc finger protein CONSTANS CO F14F8_220 At5g15840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLKQESNDIGSGENNRARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPISGNSFSSMTTTHHQSEKTMTDPEKRLVVDQEEGEEGDKDAKEVASWLFPNSDKNNNNQNNGLLFSDEYLNLVDYNSSMDYKFTGEYSQHQQNCSVPQTSYGGDRVVPLKLEESRGHQCHNQQNFQFNIKYGSSGTHYNDNGSINHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQLSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKREIEAEEQGFNTMLMYNTGYGIVPSF 56C84CF9CD45E4A6 abi3-aprr1 3 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Table 1 abi3-aip2 3 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Table 1 abi3-api3 3 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Table 1 abi3-a3g22320 3 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 abi3-aprr1-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2a abi3-aip2-1 2 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2a abi3-a3g22320-1 2 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Figure 2a constans-abi3 2 9 unspecified role unspecified role prey prey Q39057:p.Pro339Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P L Wed May 02 16:48:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro339leu' Tue Jun 30 17:09:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro339Leu' region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2313556]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 528-528, sequence length 373 [EBI-2313556]528-575 Q39057:p.Arg340Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 18:49:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg340gln' Tue Jun 30 17:56:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg340Gln' 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2b abi3-aip2-2 1 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal S tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait n-terminal S tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 2c abi3-aip3 1 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal S tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal S tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 2c