MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it [Effects of acute and subacute administration of Pimenta dioica (Myrtaceae) extracts on normal and hypertensive albino rats] [Effects of acute and subacute administration of Pimenta dioica (Myrtaceae) extracts on normal and hypertensive albino rats] Rev. Biol. Trop. (0034-7744) 1997 Suárez Urhan A., Ulate Montero G., Ciccio JF. Virus - Publications including interactions involving viral proteins suggested by aceol in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Suárez Urhan A., Ulate Montero G., Ciccio JF. Virus - Publications including interactions involving viral proteins suggested by aceol Rev. Biol. Trop. (0034-7744) 1997 elne_human Neutrophil elastase Elastase-2 ELANE PMN elastase Bone marrow serine protease Medullasin Human leukocyte elastase ELA2 protein protein human Homo sapiens Human MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH 3F7610DC33CAA4B9 grab_human Granzyme B GZMB CGL1 CSPB CTLA1 GRB Granzyme-2 T-cell serine protease 1-3E Cytotoxic T-lymphocyte proteinase 2 SECT Cathepsin G-like 1 CTLA-1 Fragmentin-2 Human lymphocyte protein C11 protein protein human Homo sapiens Human MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY C652271918EF24F9 elane-gzmb 1 3 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component physical association physical association homomint mint