IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An Arabidopsis gene encoding a putative 14-3-3-interacting protein, caffeic acid/5-hydroxyferulic acid O-methyltransferase. An Arabidopsis gene encoding a putative 14-3-3-interacting protein, caffeic acid/5-hydroxyferulic acid O-methyltransferase. Biochim. Biophys. Acta (0006-3002) 1997 imex curation Zhang H., Wang J., Goodman HM. It was not possible to curate the 'genetic interaction trap' method and results referred to in the text, since not enough details regarding this experiment were available. brahz@ttacs.ttu.edu 17-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang H., Wang J., Goodman HM. It was not possible to curate the 'genetic interaction trap' method and results referred to in the text, since not enough details regarding this experiment were available. brahz@ttacs.ttu.edu Accepted 2008-MAR-12 by ORCHARD. 17-April-2008: Contacted by JYOTI. Biochim. Biophys. Acta (0006-3002) 1997 orchard Only protein-protein interactions imex curation omt1_arath Flavone 3'-O-methyltransferase 1 OMT1 COMT1 Caffeate O-methyltransferase 1 Quercetin 3'-O-methyltransferase 1 K18G13.3 At5g54160 Acetylserotonin O-methyltransferase OMT1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGSPMSPTEIASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLKKL B4380028D89C43DC 14336_arath 14-3-3-like protein GF14 lambda General regulatory factor 6 14-3-3-like protein RCI2 14-3-3-like protein AFT1 GRF6 AFT1 RCI2 F12B17_200 At5g10450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATLGRDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA 4017D23098E74891 omt1-grf6 1 3 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2 This is in agreement with the data obtained from the interaction trap experiments, which indicates that AFT1 and OMT1 could interact with each other both in vivo and in vitro.