IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interacting components of the flagellar motor of Escherichia coli revealed by the two-hybrid system in yeast. Interacting components of the flagellar motor of Escherichia coli revealed by the two-hybrid system in yeast. J. Mol. Biol. (0022-2836) 1996 imex curation Marykwas DL., Schmidt SA., Berg HC. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Marykwas DL., Schmidt SA., Berg HC. Accepted 2008-NOV-22 by ORCHARD. J. Mol. Biol. (0022-2836) 1996 orchard Only protein-protein interactions imex curation flim_ecoli Flagellar motor switch protein FliM fla AII fla QII b1945 fliM cheC2 JW1929 protein protein ecoli Escherichia coli (strain K12) MGDSILSQAEIDALLNGDSEVKDEPTASVSGESDIRPYDPNTQRRVVRERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLNPGDVLPIEKPDRIIAHVDGVPVLTSQYGTLNGQYALRIEHLINPILNSLNEEQPK DIP protein P06974 original sequence version: null 05DC012B9364BFD6 flin_ecoli Flagellar motor switch protein FliN fliN flaN motD b1946 JW1930 protein protein ecoli Escherichia coli (strain K12) MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR 93A77AE3FEF33091 flig_ecoli Flagellar motor switch protein FliG fliG fla AII.2 fla BII b1939 JW1923 protein protein ecoli Escherichia coli (strain K12) MSNLTGTDKSVILLMTIGEDRAAEVFKHLSQREVQTLSAAMANVTQISNKQLTDVLAEFEQEAEQFAALNINANDYLRSVLVKALGEERAASLLEDILETRDTASGIETLNFMEPQSAADLIRDEHPQIIATILVHLKRAQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDGQNLKRSKMGGVRTAAEIINLMKTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEQPLREKFLRNMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSGEDTYV DIP protein P0ABZ1 original sequence version: 85 E5CB4C0415C6E178 flii_ecoli Flagellum-specific ATP synthase fliI fla AIII flaC b1941 JW1925 protein protein ecoli Escherichia coli (strain K12) MTTRLTRWLTTLDNFEAKMAQLPAVRRYGRLTRATGLVLEATGLQLPLGATCVIERQNGSETHEVESEVVGFNGQRLFLMPLEEVEGVLPGARVYAKNISAEGLQSGKQLPLGPALLGRVLDGSGKPLDGLPSPDTTETGALITPPFNPLQRTPIEHVLDTGVRPINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGAEGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNGISGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAGHYPAIDIEASISRAMTALISEQHYARVRTFKQLLSSFQRNRDLVSVGAYAKGSDPMLDKAIALWPQLEGYLQQGIFERADWEASLQGLERIFPTVS 962D4268E8428C93 flig-flim 1 2 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 10 physical association physical association 1,2, 3 We found that the N-terminal 45 amino acid residues of FliG were not required for the FliG/FliM two-hybrid interaction (Figure 3). flig-flim-1 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1,2, 4 We found that the N-terminal 45 amino acid residues of FliG were not required for the FliG/FliM two-hybrid interaction (Figure 3). flim-flim 1 2 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 17 19 physical association physical association 1,2,4 flim-flin 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait c terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1,2, 4 flii-flii-3 1 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 2