MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Disulfide cross-links in the interaction of a cataract-linked alphaA-crystallin mutant with betaB1-crystallin. Disulfide cross-links in the interaction of a cataract-linked alphaA-crystallin mutant with betaB1-crystallin. FEBS Lett. (0014-5793) 2009 Kumar MS., Koteiche HA., Claxton DP., Mchaourab HS. suggested by aryamontri in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Kumar MS., Koteiche HA., Claxton DP., Mchaourab HS. suggested by aryamontri FEBS Lett. (0014-5793) 2009 Disulfide cross-links in the interaction of a cataract-linked alphaA-crystallin mutant with betaB1-crystallin. Disulfide cross-links in the interaction of a cataract-linked alphaA-crystallin mutant with betaB1-crystallin. FEBS Lett. (0014-5793) 2009 Kumar MS., Koteiche HA., Claxton DP., Mchaourab HS. suggested by aryamontri in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Kumar MS., Koteiche HA., Claxton DP., Mchaourab HS. suggested by aryamontri FEBS Lett. (0014-5793) 2009 crbb1_mouse Beta-crystallin B1 Crybb1 Beta-B1 crystallin protein protein mouse Mus musculus Mouse MSQAAKASATTAVNPGPDGKGKGAPSTGPAPAPGPTPVPASVPRPAAKVGDLPPGSYRLIVFEQENFQGRRVEFSGECLNLGDRGFDRVRSLIVVSGPWVAFEQSAFRGEMFVLEKGEYPRWDTWTSSYRSDRLMSFRPIRMDSQEHKICLFEGANFKGNTMEIQEDDVPSLWVYGFCDRVGSITVSGGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQAVRRLRDRQWHQEGCFPVLTAEPPK mint Crystallins are the dominant structural components of the vertebrate eye lens CCF26E7D2F6B92EF cryab_rat Alpha-crystallin B chain Alpha(B)-crystallin Cryab protein protein rat Rattus norvegicus (Rat) Rat MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK AB66796291518B9B crybb1-cryab 1 beta B1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified alpha crystallin 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F1 homomint mint cryab-crybb1 2 beta B1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified alpha crystallin 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F3 homomint mint