IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Membrane Binding by tBid Initiates an Ordered Series of Events Culminating in Membrane Permeabilization by Bax. Membrane Binding by tBid Initiates an Ordered Series of Events Culminating in Membrane Permeabilization by Bax. Cell (0092-8674) 2008 imex curation Lovell JF., Billen LP., Bindner S., Shamas-Din A., Fradin C., Leber B., Andrews DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Assays were performed in the presence of liposomes, into which the proteins are assumed to have inserted. Liposomes wee then lysed and proteins separated on a Superdex 200 column. Source of BAX given in PMID:15920484 referenced by the author andrewsd@mcmaster.ca 14-May-2009: Contacted by JYOTI. davet Only protein-protein interactions 4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Lovell JF., Billen LP., Bindner S., Shamas-Din A., Fradin C., Leber B., Andrews DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Assays were performed in the presence of liposomes, into which the proteins are assumed to have inserted. Liposomes wee then lysed and proteins separated on a Superdex 200 column. Source of BAX given in PMID:15920484 referenced by the author andrewsd@mcmaster.ca Accepted 2009-MAY-15 by DAVET. 14-May-2009: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 4 imex curation Membrane Binding by tBid Initiates an Ordered Series of Events Culminating in Membrane Permeabilization by Bax. Membrane Binding by tBid Initiates an Ordered Series of Events Culminating in Membrane Permeabilization by Bax. Cell (0092-8674) 2008 imex curation Lovell JF., Billen LP., Bindner S., Shamas-Din A., Fradin C., Leber B., Andrews DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Assays were performed in the presence of liposomes, into which the proteins are assumed to have inserted. Liposomes wee then lysed and proteins separated on a Superdex 200 column. Source of BAX given in PMID:15920484 referenced by the author andrewsd@mcmaster.ca 14-May-2009: Contacted by JYOTI. davet Only protein-protein interactions 4 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Lovell JF., Billen LP., Bindner S., Shamas-Din A., Fradin C., Leber B., Andrews DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Assays were performed in the presence of liposomes, into which the proteins are assumed to have inserted. Liposomes wee then lysed and proteins separated on a Superdex 200 column. Source of BAX given in PMID:15920484 referenced by the author andrewsd@mcmaster.ca Accepted 2009-MAY-15 by DAVET. Cell (0092-8674) 2008 davet Only protein-protein interactions 4 imex curation p70444-pro_0000223236 BH3-interacting domain death agonist p15 Bid p22 BID protein protein mouse Mus musculus Mouse SQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD 61 195 38E82BE1B57D7955 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 o-phosphoethanolamine Phosphoethanolamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 bax-tbid-1 2 3 unspecified role unspecified role fluorescence donor fluorescence donor P70444-PRO_0000223236:p.Gly34Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G E Wed May 02 20:17:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly34glu' Tue Jun 30 20:16:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly34Glu' cys-126 dimethylaminocoumarin (DAC) fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept cys-126 7-nitrobenzene-2-oxa-1, 3-diazol-4-yl ethylenediamine fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain Q07812:p.Cys62Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 14:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys62ala' Tue Jun 30 15:35:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys62Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Binding of Bax to tBid was examined with FRET between dimethylaminocoumarin (DAC)-labeled tBid and 7-nitrobenzene-2-oxa-1, 3-diazol-4-yl ethylenediamine (NBD)-labeled Bax. Figs. 2A, 2C, 4 Energy transfer was observed only if liposomes were also present, suggesting that the two proteins interact only when bound to membranes. pH = 7.0, Temp = 37C bax-tbid-2 2 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept cys-126 7-nitrobenzene-2-oxa-1, 3-diazol-4-yl ethylenediamine fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain Q07812:p.Cys62Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:04:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys62ala' Tue Jun 30 18:20:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys62Ala' ecoli Escherichia coli (strain K12) 6 inhibitor inhibitor ancillary ancillary bh3 region sufficient to bind sufficient binding region sufficient to bind range range range range chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role fluorescence donor fluorescence donor cys-126 dimethylaminocoumarin (DAC) fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Binding of Bax to tBid was examined with FRET between dimethylaminocoumarin (DAC)-labeled tBid and 7-nitrobenzene-2-oxa-1, 3-diazol-4-yl ethylenediamine (NBD)-labeled Bax. Fig. 2B Exact coordinates of Bid peptide not given in paper so have been inferred from the UniProtKB entry. Energy transfer was observed only if liposomes were also present, suggesting that the two proteins interact only when bound to membranes. tbid-pe-1 2 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 3 unspecified role unspecified role fluorescence donor fluorescence donor P70444-PRO_0000223236:p.Gly34Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G E Wed May 02 15:14:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly34glu' Tue Jun 30 18:25:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly34Glu' cys-126 dimethylaminocoumarin (DAC) fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association To measure tBid binding to liposomes, we incubated DAC-tBid with liposomes labeled by including 0.5% w/w 1-Oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]dodecanoyl]-sn-Glycero-3-Phosphoethanolamine (NBD-PE). Fig. 3A Phosphoethanolomaine is tagged with a fluorescence dye to form 1-Oleoyl-2-[12-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]dodecanoyl]-sn-Glycero-3-Phosphoethanolamine (NBD-PE) bax-1 2 4 unspecified role unspecified role fluorescence donor fluorescence donor Q07812:p.Arg134Cys mutation mutation certain certain sequence position certain certain certain sequence position certain R C Wed May 02 15:56:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg134cys' Tue Jun 30 19:08:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg134Cys' cys-134 dimethylaminocoumarin (DAC) fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept cys-126 7-nitrobenzene-2-oxa-1, 3-diazol-4-yl ethylenediamine fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Bax oligomerization measured as FRET between DAC-134-Bax and NBD-126-Bax. Energy transfer was observed only if liposomes were also present, suggesting that the two proteins interact only when bound to membranes. Fig. 3B bax-5 1 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Bax oligomerization in liposome membranes Interaction requires the presence of a liosome membrane preparation. Supp. Fig. 1B