MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. FEBS Lett. (0014-5793) 2008 imex curation Vidi PA., Chen J., Irudayaraj JM., Watts VJ. suggested by aryamontri 2008-12-02 Only protein-protein interactions mouse-cad Mouse neuronal cell line cad Mouse neuronal cell line bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vidi PA., Chen J., Irudayaraj JM., Watts VJ. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. FEBS Lett. (0014-5793) 2008 imex curation Vidi PA., Chen J., Irudayaraj JM., Watts VJ. suggested by aryamontri 2008-12-02 Only protein-protein interactions mouse-cad Mouse neuronal cell line cad Mouse neuronal cell line fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Vidi PA., Chen J., Irudayaraj JM., Watts VJ. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. FEBS Lett. (0014-5793) 2008 imex curation Vidi PA., Chen J., Irudayaraj JM., Watts VJ. suggested by aryamontri 2008-12-02 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vidi PA., Chen J., Irudayaraj JM., Watts VJ. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation aa2ar_human Adenosine receptor A2a ADORA2A ADORA2 protein protein human Homo sapiens Human MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS 9438E9D64A6BE61B adora2a-adora2a-3 2 A2AR 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A2AR 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction F3 homomint mint adora2a-adora2a-4 1 A2AR 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A2AR 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A F2A homomint mint adora2a-adora2a-5 3 A2AR 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A2AR 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A homomint mint