MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural and functional mapping of the archaeal multi-aminoacyl-tRNA synthetase complex. Structural and functional mapping of the archaeal multi-aminoacyl-tRNA synthetase complex. FEBS Lett. (0014-5793) 2008 imex curation Hausmann CD., Ibba M. suggested by aryamontri Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hausmann CD., Ibba M. suggested by aryamontri FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Structural and functional mapping of the archaeal multi-aminoacyl-tRNA synthetase complex. Structural and functional mapping of the archaeal multi-aminoacyl-tRNA synthetase complex. FEBS Lett. (0014-5793) 2008 imex curation Hausmann CD., Ibba M. suggested by aryamontri Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Hausmann CD., Ibba M. suggested by aryamontri FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation syp_metth Proline--tRNA ligase Prolyl-tRNA synthetase MTH_611 proS protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MQKPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDRDHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRGIISFMWCGEEECGMDVEEKVRVDILGIQEEGSGTCINCGREAPTGLTLPEHIS Catalyzes the attachment of proline to tRNA(Pro) in a two-step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA(Pro). Can inadvertently accommodate and process cysteine mint 57D81ED7E9496BAA syl_metth Leucine--tRNA ligase Leucyl-tRNA synthetase MTH_1508 leuS protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MDIERKWRDRWRDAGIFQADPDDREKIFLTVAYPYPSGAMHIGHGRTYTVPDVYARFKRMQGYNVLFPMAWHVTGAPVIGIARRIQRKDPWTLKIYREVHRVPEDELERFSDPEYIVEYFSREYRSVMEDMGYSIDWRREFKTTDPTYSRFIQWQIRKLRDLGLVRKGAHPVKYCPECENPVGDHDLLEGEGVAINQLTLLKFKLGDSYLVAATFRPETIYGATNLWLNPDEDYVRVETGGEEWIISRAAVDNLSHQKLDLKVSGDVNPGDLIGMCVENPVTGQEHPILPASFVDPEYATGVVFSVPAHAPADFIALEDLRTDHELLERYGLEDVVADIEPVNVIAVDGYGEFPAAEVIEKFGVRNQEDPRLEDATGELYKIEHARGVMSSHIPVYGGMKVSEAREVIADELKDQGLADEMYEFAERPVICRCGGRCVVRVMEDQWFMKYSDDAWKDLAHRCLDGMKIIPEEVRANFEYYIDWLNDWACSRRIGLGTRLPWDERWIIEPLTDSTIYMAYYTIAHRLREMDAGEMDDEFFDAIFLDDSGTFEDLREEFRYWYPLDWRLSAKDLIGNHLTFHIFHHSAIFPESGWPRGAVVFGMGLLEGNKMSSSKGNVILLRDAIEKHGADVVRLFLMSSAEPWQDFDWRESEVIGTRRRIEWFREFGERVSGILDGRPVLSEVTPAEPESFIGRWMMGQLNQRIREATRALESFQTRKAVQEALYLLKKDVDHYLKRVEGRVDDEVKSVLANVLHAWIRLMAPFIPYTAEEMWERYGGEGFVAEAPWPDFSDDAESRDVQVAEEMVQNTVRDIQEIMKILGSTPERVHIYTSPKWKWDVLRVAAEVGKLDMGSIMGRVSAEGIHDNMKEVAEFVRRIIRDLGKSEVTVIDEYSVLMDASDYIESEVGARVVIHSKPDYDPENKAVNAVPLKPAIYLE mint 7EF6344EC2DC0B76 syk_metth Lysine--tRNA ligase Lysyl-tRNA synthetase MTH_1542 lysS protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MKFTHFFVALILSRFLQVISLKHWIERIADELKERDVEEHVVASGTSISGSIHIGNSCDVFIASSIAKSLKKDGFKSRTVWIADDHDPLRKVPYPLPESYEKYLGVPYSMIPCPEGCCESFVEHFQRPFLEALERFRIGVEHYSGARMYTEGLYNDYIRTSLERAPEIREIFNRFRDRPLRDDWLPYNPICEKCGRVNTTEAYDFSGDTVRYRCECGFDGEMDIKSGLGKLTWRVEWAARWKILGVTCEPFGKDHAASGGSYDVSSIISEEIFDYPAPYPVPYEWITLRGEAMSKSRGVFFTPGQWLEIGPPESLNYFIFRSKPMKHKDFNPDMPFLDLMDQFDRTERIYYGMEDAASEKEEQKLRNIYRVSMIEEFDLPLRPSYRFMTVACQIAGDDPERLYDILRRNSQLPEELMDLELDQLTDKQLEQLNERIENVKNWLRLYAPEFVKFQVQEELPDVELSEPQLKFLQDVADLMESREMSAEELHDEMYSILRRHGLKPQKAFQAIYRVLIGKKMGPRAASFLLSLERDFVIRRLRLEA mint D033EABDDEAA21CF ef1a_metth Elongation factor 1-alpha tuf MTH_1058 Elongation factor Tu protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MAKEKEHMNLAFIGHVDHGKSTLVGHLLLQAGAIAEQQLAEGEDKFRFVMDRLSEERERGVTIDLAHAKFETDKYEFTIVDCPGHRDFVKNMITGASQADAAVLVVAVDDGVMPQTKEHVFLSRTLGINQLIVAINKMDLVNYDEEKFNALKDEVAALIKTVGYKPSDVEFIPLSAFEGDNITSKSENTPWYKGKTLVEALDDLEAPEKPVDLPLRIPIQDVYSITGVGTVPVGRVETGVLKKGENVIFEPAGVSGEVKSIEMHHEMIEQAEPGDNIGFNVRGVGKNDIRRGDVAGHLDNPPKVAKEFTAQIVVLQHPGVITVGYTPVFHCHTAQVACTFLELVQKMNPATGQVEEENPDFLKTGNAAVVKVKPTKPLVIEKIKDIPHMGRFAIRDMGQTVAAGMCIDLVPAK mint This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis 0C8E457913A0D26D tuf-leus 1 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain CP1 range MINT-6551083: original sequence: 196-422 : NQLTLLKFKLGDSYLVAATFRPETIYGATNLWLNPDEDYVRVETGGEEWIISRAAVDNLSHQKLDLKVSGDVNPGDLIGMCVENPVTGQEHPILPASFVDPEYATGVVFSVPAHAPADFIALEDLRTDHELLERYGLEDVVADIEPVNVIAVDGYGEFPAAEVIEKFGVRNQEDPRLEDATGELYKIEHARGVMSSHIPVYGGMKVSEAREVIADELKDQGLADEM EF1A 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2 kd 280 nanomolar mint leus-tuf 2 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:56:30 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 196-422 range MINT-6664516: original sequence: 196-422 : NQLTLLKFKLGDSYLVAATFRPETIYGATNLWLNPDEDYVRVETGGEEWIISRAAVDNLSHQKLDLKVSGDVNPGDLIGMCVENPVTGQEHPILPASFVDPEYATGVVFSVPAHAPADFIALEDLRTDHELLERYGLEDVVADIEPVNVIAVDGYGEFPAAEVIEKFGVRNQEDPRLEDATGELYKIEHARGVMSSHIPVYGGMKVSEAREVIADELKDQGLADEM EF1A 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t2 kd 90 nanomolar mint leus-lyss 2 LysRS 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:56:52 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 196-492 range MINT-6664495: original sequence: 196-492 : NQLTLLKFKLGDSYLVAATFRPETIYGATNLWLNPDEDYVRVETGGEEWIISRAAVDNLSHQKLDLKVSGDVNPGDLIGMCVENPVTGQEHPILPASFVDPEYATGVVFSVPAHAPADFIALEDLRTDHELLERYGLEDVVADIEPVNVIAVDGYGEFPAAEVIEKFGVRNQEDPRLEDATGELYKIEHARGVMSSHIPVYGGMKVSEAREVIADELKDQGLADEMYEFAERPVICRCGGRCVVRVMEDQWFMKYSDDAWKDLAHRCLDGMKIIPEEVRANFEYYIDWLNDWACSR his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t2 kd 40 nanomolar mint leus-pros 2 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:33:40 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 890-937 range MINT-6664592: original sequence: 890-937 : DEYSVLMDASDYIESEVGARVVIHSKPDYDPENKAVNAVPLKPAIYL ProRS 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t2 kd 80 nanomolar mint leus-lyss-1 2 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LysRS 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction kd 170 nanomolar t2 mint leus-pros-1 2 ProRS 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:34:13 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1-8 range MINT-6664573: original sequence: 1-8 : MDIERKWRDRWRDAGIF his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t2 kd 110 nanomolar mint leus-pros-2 2 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:33:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 196-422 range MINT-6664579: original sequence: 196-422 : NQLTLLKFKLGDSYLVAATFRPETIYGATNLWLNPDEDYVRVETGGEEWIISRAAVDNLSHQKLDLKVSGDVNPGDLIGMCVENPVTGQEHPILPASFVDPEYATGVVFSVPAHAPADFIALEDLRTDHELLERYGLEDVVADIEPVNVIAVDGYGEFPAAEVIEKFGVRNQEDPRLEDATGELYKIEHARGVMSSHIPVYGGMKVSEAREVIADELKDQGLADEM ProRS 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t2 kd 110 nanomolar mint leus-lyss-2 2 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:27:50 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 1-8 range MINT-6664602: original sequence: 1-8 : MDIERKWRDRWRDAGIF LysRS 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction t2 kd 50 nanomolar mint leus-tuf-1 2 LeuRS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:07 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 890-937 range MINT-6664618: original sequence: 890-937 : DEYSVLMDASDYIESEVGARVVIHSKPDYDPENKAVNAVPLKPAIYL EF1A 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction kd 150 nanomolar t2 mint