IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AtMYBL2, a protein with a single MYB domain, acts as a negative regulator of anthocyanin biosynthesis in Arabidopsis. AtMYBL2, a protein with a single MYB domain, acts as a negative regulator of anthocyanin biosynthesis in Arabidopsis. Plant J. (0960-7412) 2008 imex curation Matsui K., Umemura Y., Ohme-Takagi M. m-takagi@aist.go.jp 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Matsui K., Umemura Y., Ohme-Takagi M. m-takagi@aist.go.jp Accepted 2009-FEB-19 by ORCHARD. 03-Mar-2009: Contacted by JYOTI. Plant J. (0960-7412) 2008 orchard Only protein-protein interactions imex curation q39028_arath Atmyb2 MYB2 ATMYB2 MYB DOMAIN PROTEIN 2 myb domain protein 2 T8I13.3 At2g47190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDYERINSNSPTHEEDSDVRKGPWTEEEDAILVNFVSIHGDARWNHIARSSGLKRTGKSCRLRWLNYLRPDVRRGNITLEEQFMILKLHSLWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQAKHLRCDVNSNLFKETMRNVWMPRLVERINAQSLPTTCEQVESMITDPSQPVNEPSPVEPGFVQFSQNHHQQFVPATELSATSSNSPAETFSDVRGGVVNGSGYDPSGQTGFGEFNDWGCVGGDNMWTDEESFWFLQDQFCPDTTSYSYN 94BAE5F38C3854DF myb75_arath Transcription factor MYB75 MYB75 PAP1 SIAA1 F25P12.92 At1g56650 Myb-related protein 75 Production of anthocyanin pigment 1 protein Suc-induced anthocyanin accumulation locus 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYLKPSIKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKIKMKKRDITPIPTTPALKNNVYKPRPRSFTVNNDCNHLNAPPKVDVNPPCLGLNINNVCDNSIIYNKDKKKDQLVNNLIDGDNMWLEKFLEESQEVDILVPEATTTEKGDTLAFDVDQLWSLFDGETVKFD B86103A9AB5CF442 tt8_arath Transcription factor TT8 TT8 BHLH42 Basic helix-loop-helix protein 42 EN32 Transcription factor EN 32 Protein TRANSPARENT TESTA 8 bHLH transcription factor bHLH042 F17A8.170 At4g09820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDESSIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKTTQPAEVTAEEAALERSQQLRELYETLLAGESTSEARACTALSPEDLTETEWFYLMCVSFSFPPPSGMPGKAYARRKHVWLSGANEVDSKTFSRAILAKSAKIQTVVCIPMLDGVVELGTTKKVREDVEFVELTKSFFYDHCKTNPKPALSEHSTYEVHEEAEDEEEVEEEMTMSEEMRLGSPDDEDVSNQNLHSDLHIESTHTLDTHMDMMNLMEEGGNYSQTVTTLLMSHPTSLLSDSVSTSSYIQSSFATWRVENGKEHQQVKTAPSSQWVLKQMIFRVPFLHDNTKDKRLPREDLSHVVAERRRREKLNEKFITLRSMVPFVTKMDKVSILGDTIAYVNHLRKRVHELENTHHEQQHKRTRTCKRKTSEEVEVSIIENDVLLEMRCEYRDGLLLDILQVLHELGIETTAVHTSVNDHDFEAEIRAKVRGKKASIAEVKRAIHQVIIHDTNL 25988482FE25C99C atmybl2-tt8 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 6b Protein-protein interaction between AtMYB2 and TT8 The author provided the details of the tuncated Atmyb2 c-terminal construct "AtMYBL2deltaC (1- 182) represents deletion of 13 amino acid at C-terminal as shown at the construct (5th from the bottom) in Figure 3". t8-2 1 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Figure 6b TT8 forms a homodimer t8-myb75 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 6b TT8 interacts with PAP1