MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil. EMBO J. (0261-4189) 2008 imex curation Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. 2008-11-28 Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Conners R., Hill DJ., Borodina E., Agnew C., Daniell SJ., Burton NM., Sessions RB., Clarke AR., Catto LE., Lammie D., Wess T., Brady RL., Virji M. EMBO J. (0261-4189) 2008 2008-11-28 Only protein-protein interactions imex curation q8gh87_morca uspa1 protein protein morca Moraxella catarrhalis MNKIYKVKKNAAGHLVACSEFAKGHTKKAVLGSLLIVGILGMATTASAQAINTGQGTVVDQNGNEAIGNYSTASGGDYNQAKGNYSTASGGSGNTAEGNYSTASGGLGNTAEGNYSTASGGLGNTAKGKYSTVAGGANNQAKGDYSTASGGSGNTAEGNYSTVAGGKNNQATGLNSTVAGGSDNQATGTGSFAAGVGNKANAENAVALGNKNTIEGENSVAIGSNNTVETGKENVFILGSGTTGVTSNSVLLGNKTAGKEATAVNDATVNGLTLKNFAGVSKTGNGTVSVGSENHERQIVNVGAGKISADSTDAVNGSQLHALATVVAKNKSDITKNQAETLVNRVNIKELERKQENDIKEVVEMQNAIAEQADKNKNHIQDLAKAQLAGVTVMEELNKHVEDLYEATNDNLDKISQLDGAVFNNTQNIAKNSNHIKTLENNVEEELLNLSGRLLDQKADIDNNINNIYELAQQQDQHSSDIKTLKNNVEEGLLDLSGRLIDQKADLTKDIKALENNVEEGLLDLSGRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIANNIKNIYELAQQQDQHSSDIKTLAKVSAANTDRIAKNKAEADASFETLTKNQNTLIEQGEALVEQNKAINQELEGFAAHADVQDKQILQNQADITTNKTAIEQNINRTVANGFEIEKNKAGIATNKQELILQNDRLNRINETNNRQDQKIDQLGYALKEQGQHFNNRISAVERQTAGGIANAIAIATLPSPSRAGEHHVLFGSGYHNGQAAVSLGAAGLSDTGKSTYKIGLSWSDAGGLSGGVGGSYRWK mint 37764460BA463513 ceam1_human Carcinoembryonic antigen-related cell adhesion molecule 1 CEACAM1 BGP BGP1 Biliary glycoprotein 1 protein protein human Homo sapiens Human MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ DIP protein P13688 original sequence version: 164 CAD1B2328D069AF8 uspa1 6 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798511: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN Stoichiometry: 3.0 direct interaction direct interaction f2 The crystal structure confirms that three polypeptide strands coalesce to form a left-handed trimeric coiled-coil. mint ceacam1-uspa1 2 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798529: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4a mint uspa1-ceacam1 1 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798552: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f4c mint ceacam1-uspa1-1 4 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798541: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4b mint uspa1-ceacam1-1 5 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:38:12 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Leu583Ala range MINT-6798580: original sequence: 583-583 : ALNKASSANTDRIATAELGI binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798570: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-2 5 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Met586Ala range MINT-6798616: original sequence: 586-586 : KASSANTDRIATAELGIAEN binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798618: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-3 5 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:13:49 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ala590Glu range MINT-6798660: original sequence: 590-590 : ANTDRIATAELGIAENKKDA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798658: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-4 5 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ala590Glu range MINT-6798679: original sequence: 590-590 : ANTDRIATAELGIAENKKDA undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:31 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 586 range MINT-6798688: original sequence: 586-586 : KASSANTDRIATAELGIAEN binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798681: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-5 7 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798592: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:48 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Leu583Ala range MINT-6798590: original sequence: 583-583 : ALNKASSANTDRIATAELGI N-CEACAM1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-6 7 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798603: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:16:23 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Met586Ala range MINT-6798605: original sequence: 586-586 : KASSANTDRIATAELGIAEN N-CEACAM1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-7 7 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798696: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:16:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ala590Glu range MINT-6798698: original sequence: 590-590 : ANTDRIATAELGIAENKKDA undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:16:41 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 586 range MINT-6798694: original sequence: 586-586 : KASSANTDRIATAELGIAEN N-CEACAM1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint uspa1-ceacam1-8 7 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798715: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:17:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ala590Glu range MINT-6798713: original sequence: 590-590 : ANTDRIATAELGIAENKKDA N-CEACAM1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f5c mint ceacam1-uspa1-2 3 uspa1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6798728: original sequence: 527-665 : GRLIDQKADIAKNQADIAQNQTDIQDLAAYNELQDAYAKQQTEAIDALNKASSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIAN N-CEACAM1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f6 mint