IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Cell (0092-8674) 2008 imex curation Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 18 in vitro In vitro phosphatase assay phosphatase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 18 imex curation Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Cell (0092-8674) 2008 imex curation Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 18 in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 18 imex curation Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Cell (0092-8674) 2008 imex curation Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 18 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 18 imex curation Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Cell (0092-8674) 2008 imex curation Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 18 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. Multi-angle light scattering was used to measure the molecular weight of purified proteins. urs.jenal@unibas.ch Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 18 imex curation Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Cell (0092-8674) 2008 imex curation Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 18 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. Purified protein was cross-linked using 2 mM disuccinimidyl suberate. urs.jenal@unibas.ch Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 18 imex curation Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Allosteric regulation of histidine kinases by their cognate response regulator determines cell fate. Cell (0092-8674) 2008 imex curation Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 18 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Paul R., Jaeger T., Abel S., Wiederkehr I., Folcher M., Biondi EG., Laub MT., Jenal U. Diguanylate cyclase assay catalyzes the condensation of two GTP molecules to the cyclic dinucleotide di-GMP (c-di-GMP), which acts as a secondary messenger. urs.jenal@unibas.ch Accepted 2008-SEP-5 by DAVET. Cell (0092-8674) 2008 davet Only protein-protein interactions 18 imex curation divj_cauvc Histidine protein kinase DivJ divJ CC_1063 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MILPTALKSRLALEFETLPDPFRRPAARAAGLDPAHAWRLGWLAAVCLAAAAALFTADSGGWPVWAALGAGALPALVSLIFTREDERTQSWLLVLWAVGGSLAAVLTGGVGGAMAAWCLAPVAAASTQDQPKRLAEGAALALIGACVAALTQLSGLAPAAPTGPLAFVLGFLALVTTGLGLAAGLLIGRRRQGARDDRYASEIIGLETLLDGLPHLAIAVRGQGQVTAVRGAAPPGVTRADLVNRGLTGAAAPGDRQRLTAAIAQAHREGSASLTFNPALGVERVVALDMHRVAPNQLVGVLRDITVERHREHALDQARIDAEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPLSDRYAEYAELIHESGGHLLDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGVLPPGELEVDADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISPEDLERLGRPYEQAGGAEQRARGTGLGLSLVRAFAQLHGGEMVIESRLGAGTTVSVRLPVLLAPMVAATPTPPAAPEAPSAPEPAPTVEEPPPASLGDNVIAFAPR 802B532B749B37EA 802B532B749B37EA q45976_cauvi divK protein protein cauce Caulobacter crescentus Caulobacter crescentus MTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLERQPA DIP protein Q45976 original sequence version: 55 5C70277599EEEDB4 plec_cauvc Non-motile and phage-resistance protein pleC CC_2482 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MGRHGGPAAAGPTAPSAVRAKAVNAPSQVFVRIAILAALLLLAVYTAFGVHRLQREAMAQPGGAPLAAKADLIAGRVDANLAAQRAGLSAAADLLKRDPGATMDAAETTLRAAGGEAAAVAVVSEAGVVAVAGRDDGADWKAAALAAGASGRTNWVGSVGETGRLYVATTTSLDRARAFVIASGDASRLVADPEKGESGALALPDGKLIAARGRGVQGAGALREAFALSIEDLGDGPAAVRGQAADGALLDVAVRPVAQGALLAVAAAPTRSVANLDRQVMEGAFSLLVPLGVGIALALLLMIQSRKAEVAHREFIDSERRFRLAVEAARCGIWEWDLNGDQVYLSDVTGAMFGWGGGGVVSGQDLLERISIDHRERVRQALANAAMYGAFDVSFRVPASEQGARSLWIDARGQGFGKPGSEGHARIIGVALDVTEERIAQARAQAAENRLRDAIESVSEAFVLWDRQGRLLMCNRNYRSVFSLEPKILKPGAARAEVNRFAALAIKQDHPAPDGAKGVREAEMMDGRWIQISERRTAEGGLVMTAADITAIKTQEEARRRNEEQLQNAVAGLERSQEQLAELARKYETEKVKAESANKAKSEFLANMSHELRTPLNAINGFSEIMMNEMFGPLGDQRYKGYSQDIHSSGQHLLALINDILDMSKIEAGKMNLKFESMHLEDVAEDAVRLVRNRAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSNAIKFTPRAGSVTVRAEVRRDPFGDLIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTTQGTGLGLALTKSLITMHDGVLEMHSTPGEGTTVSFTLPVRHSDQKITRDFVAA DCFF4F092DE2CBF8 DCFF4F092DE2CBF8 pled_cauvc Response regulator PleD pleD CC_2462 Stalked cell differentiation-controlling protein protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MSARILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTRFKLVIDELRQREASGRRMGVIAGAAARLDGLGGRVLIVDDNERQAQRVAAELGVEHRPVIESDPEKAKISAGGPVDLVIVNAAAKNFDGLRFTAALRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRKRYTDYLRNNLDHSLELAVTDQLTGLHNRRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTISIGVSATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA D44909D42B581516 D44909D42B581516 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 pled-plec-1 6 11 enzyme target enzyme target substrate substrate neutral component neutral component 9 stimulator stimulator ancillary ancillary P37894:p.Phe778Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F L Wed May 02 16:14:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe778leu' Tue Jun 30 19:55:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe778Leu' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component Q9A5I5:p.Asp53Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:30:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 19:40:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role ancillary ancillary Q45976:p.Asp53Asn mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 14:58:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 17:13:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction To explore the regulatory link between PleD, PleC, and DivK, activation of PleD diguanylate cyclase activity was assayed in vitro in the presence of PleC and DivK. Fig. 1 The single domain response regulator DivK is able to efficiently stimulate the in vitro activity of PleD and that this activation requires an active histidine protein kinase PleC. plec-1 2 9 putative self putative self putative self putative self region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphotransfer phosphotransfer reaction phosphotransfer true To test this, PleC autophosphorylation activity was monitored Fig. 2A Phosphorylation of PleC, Supp. Fig. 1C plec-divk-1 2 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 stimulator stimulator neutral component neutral component Q45976:p.Asp53Asn mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:59:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 18:32:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' Q45976:p.[Asp53Asn;Asp90Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N certain certain sequence position certain certain certain sequence position certain D G Wed May 02 20:18:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn,asp90gly' Tue Jun 30 19:34:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp53Asn;Asp90Gly]' ecoli Escherichia coli (strain K12) phosphotransfer phosphotransfer reaction phosphotransfer To test this, PleC autophosphorylation activity was monitored in the presence and absence of DivK Fig. 2A, 2C, Supp. Fig 1A & B DivKD53N stimulated levels of PleC autophosphorylation in a concentration dependent manner plec-pled-1 2 9 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation As a consequence of this stimulation, phosphotransfer from PleC to PleD (Figure 2B) Fig. 2B plec-pled-2 2 9 phosphate donor phosphate donor neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 stimulator stimulator ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 15:19:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 15:54:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) phosphotransfer phosphotransfer reaction phosphotransfer Phosphotransfer reactions with PleC (10 μM), DivKD53N (10 μM), and PleD (10 μM). Fig. 2B divj-divk-1 3 7 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation n vitro phosphotransfer between DivJ (2.5 μM) and the response regulators DivK (2.5 μM) Fig. 2D, 4B divj-pled-1 3 10 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Although DivJnot, vert, similarP readily served as phosphodonor for PleD Fig. 2D, 4B plec-divk-2 2 8 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) 8 stimulator stimulator ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:15:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 20:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Phosphotransfer reactions with PleC (10 μM), DivKD53N (10 μM), and PleD (10 μM). Fig. 3A, Supp. Fig 5 plec-divk-3 2 9 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation PleC-mediated phosphorylation of DivK. Fig. 3A plec-divk-4 1 9 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation PleC-mediated dephosphorylation of DivK. Fig. 3B plec-divk-5 1 8 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 inhibitor inhibitor ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 15:48:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 18:31:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation In contrast to PleC mediated phosphorylation of DivK, dephosphorylation of DivK was not increased in the presence of DivKD53N (Figures 3A�3C). Rather, the rate of DivKnot, vert, similarP dephosphorylation was reduced in the presence of DivKD53N. Fig. 3B, 3C divj-divk-4 3 8 stimulator stimulator ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 18:24:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 19:57:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' Q45976:p.[Asp53Asn;Asp90Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N certain certain sequence position certain certain certain sequence position certain D G Wed May 02 17:51:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn,asp90gly' Tue Jun 30 19:54:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp53Asn;Asp90Gly]' ecoli Escherichia coli (strain K12) 7 putative self putative self putative self putative self region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation DivK stimulates DivJ autophosphorylation Fig. 4A, Supp. Fig 1C A asp53asn, asp90gly mutant of DivK was also included in the assay but the author did not comment on any effect. divj-1 3 7 putative self putative self putative self putative self region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Autophosphorylation of DivJ Fig. 4A, Supp. Fig. 1C divj-divk-3 3 7 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 stimulator stimulator ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:00:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 19:45:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Activation of DivJ by DivKD53N led to increased phosphotransfer to the response regulators DivK Fig. 4B divj-pled-2 3 8 unspecified role unspecified role ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 17:56:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 16:32:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Activation of DivJ by DivKD53N led to increased phosphotransfer to the response regulators DivK and PleD Fig. 4B pled-1 5 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Crosslink assays with PleD, Supp Fig. 2 pled-plec-2 5 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 stimulator stimulator ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 stimulator stimulator ancillary ancillary Q45976:p.Asp53Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 20:06:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp53asn' Tue Jun 30 19:41:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp53Asn' ecoli Escherichia coli (strain K12) physical association physical association PleC-Mediated Dimerization of PleD Requires DivK. Supp Fig. 2 Whilst there was low level of dimerization of PleD in the ansence of PleC and DivK, the presence of these proteins stimulated dimer formation plec-2 4 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction PleCD marks the peak corresponding to a PleC dimer. Supp. Fig. 3 The distribution of PleC monomer and dimer fraction was not affected by preincubation with DivK. divj-2 4 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction DivJ behaved as stable dimer under all conditions tested. Supp. Fig. 4 The DivJ dimer fraction was not affected by preincubation with DivK.