IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Implications for kinetochore-microtubule attachment from the structure of an engineered Ndc80 complex. Implications for kinetochore-microtubule attachment from the structure of an engineered Ndc80 complex. Cell (0092-8674) 2008 imex curation Ciferri C., Pasqualato S., Screpanti E., Varetti G., Santaguida S., Dos Reis G., Maiolica A., Polka J., De Luca JG., De Wulf P., Salek M., Rappsilber J., Moores CA., Salmon ED., Musacchio A. andrea.musacchio@ifom-ieo-campus.it 08-Jul-2008: Contacted by JYOTI. orchard Only protein-protein interactions 1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ciferri C., Pasqualato S., Screpanti E., Varetti G., Santaguida S., Dos Reis G., Maiolica A., Polka J., De Luca JG., De Wulf P., Salek M., Rappsilber J., Moores CA., Salmon ED., Musacchio A. andrea.musacchio@ifom-ieo-campus.it Accepted 2008-JUL-20 by ORCHARD. 08-Jul-2008: Contacted by JYOTI. Cell (0092-8674) 2008 orchard Only protein-protein interactions 1 imex curation nuf2_spc24_hum_prot Human Nuf2(1-169)-Spc24(122-197) chimeric protein protein protein human Homo sapiens Human METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLERLEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW An amino acid sequence which is not represented in UniProt 6E1CA1D6DAFD539D ndc80_spc25_hum_pro Human Ndc80(80-286)-Spc25(118-224) chimeric protein protein protein human Homo sapiens Human IKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQERSTANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN An amino acid sequence which is not represented in UniProt F1018E0DCE4451FE ndc80_spc25-nuf2_spc 1 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 2.9 A R(cryst) (%) = 23.2; R(free) (%) = 26.1