IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Rac1 activation controls nuclear localization of beta-catenin during canonical Wnt signaling. Rac1 activation controls nuclear localization of beta-catenin during canonical Wnt signaling. Cell (0092-8674) 2008 imex curation Wu X., Tu X., Joeng KS., Hilton MJ., Williams DA., Long F. flong@wustl.edu 27-Aug-2008: Contacted by JYOTI. Only protein-protein interactions 3 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Wu X., Tu X., Joeng KS., Hilton MJ., Williams DA., Long F. flong@wustl.edu Accepted 2008-AUG-8 by CDEROW. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 2008 Only protein-protein interactions 3 imex curation Rac1 activation controls nuclear localization of beta-catenin during canonical Wnt signaling. Rac1 activation controls nuclear localization of beta-catenin during canonical Wnt signaling. Cell (0092-8674) 2008 imex curation Wu X., Tu X., Joeng KS., Hilton MJ., Williams DA., Long F. flong@wustl.edu 27-Aug-2008: Contacted by JYOTI. Only protein-protein interactions 3 mouse-st2 Mouse bone marrow-derived stromal cell line st2 Mouse bone marrow-derived stromal cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wu X., Tu X., Joeng KS., Hilton MJ., Williams DA., Long F. flong@wustl.edu Accepted 2008-AUG-8 by CDEROW. Cell (0092-8674) 2008 Only protein-protein interactions 3 imex curation ctnb1_mouse Catenin beta-1 Beta-catenin Ctnnb1 Catnb protein protein mouse Mus musculus Mouse MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein Q02248 original sequence version: 128 DIP protein Q02248 original sequence version: 135 DIP protein Q02248 original sequence version: 147 DIP protein Q02248 original sequence version: 187 DIP protein Q02248 original sequence version: 140 D708F170A3FBED6E rac1_mouse Ras-related C3 botulinum toxin substrate 1 Rac1 p21-Rac1 protein protein mouse Mus musculus Mouse MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63001 original sequence version: 125 ACEDF83A45E5EA67 mk08_mouse Mitogen-activated protein kinase 8 Mapk8 Jnk1 Prkm8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 protein protein mouse Mus musculus Mouse MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLAQVQQ DIP protein Q91Y86 original sequence version: 143 A7320EF933E9CF85 mk09_mouse Mitogen-activated protein kinase 9 Mapk9 Jnk2 Prkm9 Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 protein protein mouse Mus musculus Mouse MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLEGCR DIP protein Q9WTU6 original sequence version: 150 0E759B486ABCE20D p45984-1 Mitogen-activated protein kinase 9 MAPK9 JNK2 PRKM9 JNK-55 Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 Stress-activated protein kinase 1a SAPK1A protein protein human Homo sapiens Human MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR 9C15DA79981290AF ctnnb1-rac1-1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait association association To assess potential physical interactions among endogenous β-catenin, Rac1, and JNK, coimmunoprecipitation experiments were performed using cytosolic versus nuclear fractions from ST2 cells MAPK9 was phosphorylated following Wnt3a stimulation Fig. 4I, 4K ctnnb1-rac1-2 2 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait association association To assess potential physical interactions among endogenous β-catenin, Rac1, and JNK, coimmunoprecipitation experiments were performed using cytosolic versus nuclear fractions from ST2 cells Fig. 4I The Rac1 immunoprecipitate contained a significantly higher level of phospho-JNK2 in the presence of Wnt3a. mapk9-ctnnb1-1 1 3 enzyme target enzyme target substrate substrate neutral component neutral component Q02248:p.Ser246Ala Alters kinetics of interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:04:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser246ala' Tue Jun 30 19:49:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser246Ala' Q02248:p.Ser191Ala Alters kinetics of interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:08:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser191ala' Tue Jun 30 15:50:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser191Ala' Q02248:p.Ser605Ala Alters kinetics of interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:13:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser605ala' Tue Jun 30 16:09:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser605Ala' Q02248:p.[Ser191Ala;Ser246Ala;Ser605Ala] Alters kinetics of interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 11:02:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser246ala,ser605ala,ser191ala' Wed May 02 16:54:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser191ala,ser246ala,ser605ala' Tue Jun 30 19:11:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser191Ala;Ser246Ala;Ser605Ala]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-st2 Mouse bone marrow-derived stromal cell line st2 Mouse bone marrow-derived stromal cell line 7 enzyme enzyme neutral component neutral component phosphorylation phosphorylation reaction phosphorylation Phosphorylation of Ctnnb1 The S246A B-catenin showed a 20% reduction in phosphorylation, but S191A virtually eliminated phosphorylation and S605A reduced it by 75%. The triple mutant B-catenin incorporated no 32P. Fig. 6B