IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosducin-Like Protein 3 Is Required for Microtubule-Dependent Steps of Cell Division but Not for Meristem Growth in Arabidopsis. Phosducin-Like Protein 3 Is Required for Microtubule-Dependent Steps of Cell Division but Not for Meristem Growth in Arabidopsis. Plant Cell (1040-4651) 2008 imex curation Castellano MM., Sablowski R. robert.sablowski@bbsrc.ac.uk 25-Jun-2008: Contacted by JYOTI. Arabidopsis cDNA library made from inflorescence tissue. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Castellano MM., Sablowski R. robert.sablowski@bbsrc.ac.uk Accepted 2008-JUN-19 by ORCHARD. 25-Jun-2008: Contacted by JYOTI. Arabidopsis cDNA library made from inflorescence tissue. Plant Cell (1040-4651) 2008 orchard Only protein-protein interactions imex curation Phosducin-Like Protein 3 Is Required for Microtubule-Dependent Steps of Cell Division but Not for Meristem Growth in Arabidopsis. Phosducin-Like Protein 3 Is Required for Microtubule-Dependent Steps of Cell Division but Not for Meristem Growth in Arabidopsis. Plant Cell (1040-4651) 2008 imex curation Castellano MM., Sablowski R. robert.sablowski@bbsrc.ac.uk 25-Jun-2008: Contacted by JYOTI. Arabidopsis cDNA library made from inflorescence tissue. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Castellano MM., Sablowski R. robert.sablowski@bbsrc.ac.uk Accepted 2008-JUN-19 by ORCHARD. Arabidopsis cDNA library made from inflorescence tissue. Plant Cell (1040-4651) 2008 orchard Only protein-protein interactions imex curation tbb2_arath Tubulin beta-2/beta-3 chain TUBB2 TUBB3 TUB2 TUB3 MRG21.11 MRG21.12 At5g62690 At5g62700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQMWDSKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEGDYEDEEEGEYQQEEEY DF4C996D75A9A219 tbb4_arath Tubulin beta-4 chain TUBB4 TUB4 K9L2.12 At5g44340 Beta-4-tubulin protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGQYVGDSPLQLERIDVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENSDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALSVPELTQQMWDAKNMMCAADPRHGRYLTASAVFRGKLSTKEVDEQMMNIQNKNSSYFVEWIPNNVKSSVCDIAPKGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATAGEEEYEEEEEEYET EEDC37FE26D1E80D tbb5_arath Tubulin beta-5 chain TUBB5 TUB5 T20H2.21 At1g20010 Beta-5-tubulin protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDTADLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCSLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQMWDSKNMMCAADPRHGRYLTASAIFRGQMSTKEVDEQILNIQNKNSSYFVEWIPNNVKSSVCDIPPKGLKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATADEEGEYDVEEEEEGDYET E53CDF6D764417DF plp3a_arath Thioredoxin domain-containing protein PLP3A PLP3A Phosducin-like protein 3A F18B3.240 At3g50960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPDAVKSTLSNLAFGNVMAAAARNYQKEVLANEKAQGSNPVNEEVDLDELMDDPELERLHADRIAALKREVEKRESFKRQGHGEYREVSEGDFLGEVTRSEKVICHFYHKEFYRCKIMDKHLKTLAPRHVDTKFIKVDAENAPFFVTKLAIKTLPCVVLFSKGVAMDRLVGFQDLGTKDDFTTNKLENVLLKKGMLSKKKKEEDDEDAEYQESIRRSVRSSENLDSDSD 292091CEE8345F8E at3g50960-tubb2 2 3 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association Figure 6A A yeast two-hybrid screen using PLP3a as the bait yielded 89 candidate interactors out of 1.2 million clones from an Arabidopsis cDNA library. Six of these clones corresponded to three different isoforms of Arabidopsis b-tubulin (Figure 6A). In all cases, the clones contained fusions between the GAL4 activation domain and the C-terminal region of b-tubulin, suggesting that the interaction with PLP3a occurs within this region (amino acids 300 or 302 to stop for TUB2; 237 or 292 to stop for TUB3; 370 to end for TUB4 and 351 to end for TUB5). TUBB2 (At5g62690) and TUBB3 (At5g62700) are identified in UniProt as P29512. In line with IntAct rules on annotation the shortest fragment of TUBB2 or TUBB3 (in this case 302-450 amino acids residues of TUBB2) was taken as the shortest interacting fragment. at3g50960-tubb4 2 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association Figure 6A A yeast two-hybrid screen using PLP3a as the bait yielded 89 candidate interactors out of 1.2 million clones from an Arabidopsis cDNA library. Six of these clones corresponded to three different isoforms of Arabidopsis b-tubulin (Figure 6A). In all cases, the clones contained fusions between the GAL4 activation domain and the C-terminal region of b-tubulin, suggesting that the interaction with PLP3a occurs within this region (amino acids 300 or 302 to stop for TUB2; 237 or 292 to stop for TUB3; 370 to end for TUB4 and 351 to end for TUB5). at3g50960-tubb5 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 6A A yeast two-hybrid screen using PLP3a as the bait yielded 89 candidate interactors out of 1.2 million clones from an Arabidopsis cDNA library. Six of these clones corresponded to three different isoforms of Arabidopsis b-tubulin (Figure 6A). In all cases, the clones contained fusions between the GAL4 activation domain and the C-terminal region of b-tubulin, suggesting that the interaction with PLP3a occurs within this region (amino acids 300 or 302 to stop for TUB2; 237 or 292 to stop for TUB3; 370 to end for TUB4 and 351 to end for TUB5). at3g50960-tubb2-1 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 6B TUBB2 (At5g62690) and TUBB3 (At5g62700) are identified in UniProt as P29512.