MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. FEBS Lett. (0014-5793) 2008 imex curation Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. FEBS Lett. (0014-5793) 2008 imex curation Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2009-01-08 Only protein-protein interactions human-testis Homo sapiens testis anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. FEBS Lett. (0014-5793) 2008 imex curation Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2009-01-08 Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. FEBS Lett. (0014-5793) 2008 imex curation Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation np1l1_human Nucleosome assembly protein 1-like 1 NAP1L1 NRP NAP-1-related protein protein protein human Homo sapiens Human MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ E5B2EAA4EAE551D2 ttl10_human Inactive polyglycylase TTLL10 Tubulin--tyrosine ligase-like protein 10 TTLL10 protein protein human Homo sapiens Human MDHSCTRFIHRRGPPTRTRAGFKRGKRPRIQQRPRARVSGTIPASRLHPAPASQPGPCPAPGHCPVGPAHERPMGSSQEEGLRCQPSQPDHDADGHCGPDLEGAERASATPGPPGLLNSHRPADSDDTNAAGPSAALLEGLLLGGGKPSPHSTRPGPFFYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLVLETFRKSLRGQKMLPLLSQRRFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKSSGPPMPHAPDQPGARRPAPPPLVPQRPRPPGPDLDSAHDGEPQAPGTEQSGTGNRHPAQEPSPGTAKEEREEPENARP Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. May catalyze ligation of glycine residues to tubulin mint AF81F9215D73A446 ttll10-nap1l1 4 TTLL10 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell NAP1 5 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2D homomint mint ttll10-nap1l1-1 4 TTLL10 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell NAP1 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2E homomint mint ttll10-nap1l1-2 2 TTLL10 6 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NAP1 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2F homomint mint nap1l1-ttll10 1 TTLL10 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NAP1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint F2G nap1l1-ttll10-1 3 TTLL10 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:58:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Glu499Val range MINT-6493337: original sequence: 499-499 : LGYFDLIGCDFLIDDNFKVW NAP1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified glycosylated residue glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction F2H homomint mint