IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Active caspase-1 is a regulator of unconventional protein secretion. Active caspase-1 is a regulator of unconventional protein secretion. Cell (0092-8674) 2008 imex curation Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch 25-Jun-2008: Contacted by JYOTI. Only protein-protein interactions 9 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Accepted 2008-MAY-30 by CDEROW. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation Active caspase-1 is a regulator of unconventional protein secretion. Active caspase-1 is a regulator of unconventional protein secretion. Cell (0092-8674) 2008 imex curation Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch 25-Jun-2008: Contacted by JYOTI. Only protein-protein interactions 9 human-cls Homo sapiens fibroblast cell line (GM03318) cls Human fibroblast obtained from patients with Coffin-Lowry Syndrome (CLS). GM03318 (NIGMS Human Genetic Cell Repository) Catalog ID GM03318 (NIGMS Human Genetic Cell Repository) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis Fibroblasts were UVA irradiated. Experiments showed that caspase-1 interacted with FGF-2 through the p20 subunit but the source of FGF2 used could not be traced. dietmar.beer@cell.biol.ethz.ch Accepted 2008-MAY-30 by CDEROW. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation Active caspase-1 is a regulator of unconventional protein secretion. Active caspase-1 is a regulator of unconventional protein secretion. Cell (0092-8674) 2008 imex curation Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch 25-Jun-2008: Contacted by JYOTI. Only protein-protein interactions 9 human-keratinocyte Homo sapiens keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Accepted 2008-MAY-30 by CDEROW. Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation Active caspase-1 is a regulator of unconventional protein secretion. Active caspase-1 is a regulator of unconventional protein secretion. Cell (0092-8674) 2008 imex curation Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch 25-Jun-2008: Contacted by JYOTI. Only protein-protein interactions 9 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Accepted 2008-MAY-30 by CDEROW. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation Active caspase-1 is a regulator of unconventional protein secretion. Active caspase-1 is a regulator of unconventional protein secretion. Cell (0092-8674) 2008 imex curation Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch 25-Jun-2008: Contacted by JYOTI. Only protein-protein interactions 9 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Accepted 2008-MAY-30 by CDEROW. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation p29466-pro_0000004522 Caspase-1 subunit p20 CASP1 IL1BC IL1BCE Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 protein protein human Homo sapiens Human NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD 120 297 6E7413E046F7629E il1a_human Interleukin-1 alpha IL1A IL1F1 Hematopoietin-1 protein protein human Homo sapiens Human MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA DIP protein P01583 original sequence version: 168 CBCCC49569D9ED40 fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH DIP protein P29466 original sequence version: 155 DIP protein P29466-1 original sequence version: 169 DIP protein P29466 original sequence version: 169 DIP protein P29466 original sequence version: 163 DIP protein P29466 original sequence version: 101 DIP protein P29466 original sequence version: 160 DIP protein P29466 original sequence version: 184 ABF33CF33CC71584 il1a-casp1-1 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Interestingly, the amount of caspase-1 bound to IL-1α was clearly enhanced 30 min after irradiation (Figure 3A). Figure 3A 50 mJ/cm2 UVB 30 min il1a-casp1-2 4 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Caspase-1 Binds to proIL-1α Figure 3B P01583; P29466 transfection P01583; P29466 overexpressed il1a-casp1-3 1 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association P01583; P29466 transfection ProIL-1α bound to the p20 subunit of caspase-1 Fig. 3B il1a-casp1-6 1 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association P01583; P29466 transfection ProIL-1α bound to the p20 subunit of caspase-1 Fig. 3B il1a-casp1-4 5 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Caspase-1 Binds to proIL-1α Figure 3B P01583; P29466 transfection fgf2-casp1-1 2 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association CoIP of endogenous FGF-2 and procaspase-1 from lysates of human primary fibroblasts. Figure 4D fgf2-casp1-2 2 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association CoIP of endogenous FGF-2 and procaspase-1 from lysates of human primary fibroblasts. Figure 4D il1a-casp1-5 1 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association P01583; P29466 transfection ProIL-1α bound to the p20 subunit of caspase-1 Fig. 3C il1a-casp1-7 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association P01583; P29466 transfection ProIL-1α bound to the p20 subunit of caspase-1 Fig. 3C