MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions mouse-spermatogenic Mus musculus spermatogonium spermatogenic cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions mouse-testis Mus musculus testis testis cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions mouse-testis Mus musculus testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions. FEBS Lett. (0014-5793) 2008 imex curation Choi HS., Lee SH., Kim H., Lee Y. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Choi HS., Lee SH., Kim H., Lee Y. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation bip_mouse Endoplasmic reticulum chaperone BiP Immunoglobulin heavy chain-binding protein Hspa5 Grp78 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein mouse Mus musculus Mouse MMKFTVVAAALLLLGAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL DIP protein P20029 original sequence version: 154 DIP protein P20029 original sequence version: 113 DIP protein P20029 original sequence version: 112 DIP protein P20029 original sequence version: 117 DIP protein P20029 original sequence version: 165 AFB795D15E20FAC2 clgn_mouse Calmegin Clgn Meg1 MEG 1 antigen Calnexin-T A2/6 protein protein mouse Mus musculus Mouse MRFQGVGLCLGLLFITVNADFMDDGVEVEDFSENSDESNIKDEPSSGTFKYKTPQPIGEVYFTETFDSGNLAGWVLSKAKKDDMDSEIAIYDGRWEIEELKENQVPGDRGLVLKSKAKHHAIAAVLEKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTGDLILENFYDKTSYTIMFGPDKCGEDYKLHLIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVMNPDDTFEVLIDQKVVNQGTLLDDVVPPINPPREIDDPSDKKPEEWDDRAKIPDPTAVRPEDWDENEPAQIEDSSAVKPDGWLDDEPKFIPNPKAEKPEDWSDDMDGEWEAPHIPNPACQIGCGEWKPPMIDNPKYKGIWRPPMINNPNYQGLWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTPDIYFDNFIICSEKEVADQWATDGWELKIMVANANEPGVLRQLVIAAEERPWLWLMYLVMAGLPVALVASFCWPRKVKKKYEDTGPKKTELCKLQSKAALEQEAEEEKAPEKPEDVQEEKKPGEAEVVTVEKEVIGEPEEKSKEDRETLEGQEEVSKLSKSGSEDEMKDADESPGSGDAPLKSLRKRRVRKD DIP protein P52194 original sequence version: 117 mint Probably plays an important role in spermatogenesis. Binds calcium ions D70A3C418229DA00 papob_mouse Poly(A) polymerase beta Papolb Papt Tpap Polynucleotide adenylyltransferase beta Testis-specific poly(A) polymerase protein protein mouse Mus musculus Mouse MPFAVTTQGAQQPAPAPKQFGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDSFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKETADKEEFRTMWVIGLVLKKPENSEILSIDLTYDIQSFTDTVYRQAINSKMFEMDMKIAAMHLRRKELHQLLPNHVLQKKETHLTESVRLTAVTDSSLLLSIDSENSMTAPSPTGTMKTGPLTGNPQGRNSPALAVMAASVTNIQFPDVSLQHVNPIESSGIALSESIPQIPSQPTISPPPKPTMTRVVSSTHLVNHPSRPSGNTATNIPNPILGV mint E10EE49B140A1086 gsg1_mouse Germ cell-specific gene 1 protein Gsg1 Germ cell-associated protein 1 protein protein mouse Mus musculus Mouse MAKMEFQKGSSDQRTFISAILNMLSLGLSTASLLSSEWFVGTQKVPKPLCGQSLAAKCFDMPMSLDGGIANTSAQEVVQYTWETGDDRFSFLAFRSGMWLSCEETMEEPGEKCRRFIELTPPAQRWLSLGAQTAYIGLQLISFLLLLTDLLLTTNPGCGLKLSAFAAVSLVLSGLLGMVAHMLYSQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMASAVTTFNMYTRMVLEFKCRHSKSFNTNPSCLAQHHRCFLPPPLTCTTHAGEPLSSCHQYPSHPIRSVSEAIDLYSALQDKEFQQGISQELKEVVEPSVEEQR mint 9AB3A42C147F2B90 papolb-gsg1 5 Tpap 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gsg1 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6167962: original sequence: 265-365 : AVTTFNMYTRMVLEFKCRHSKSFNTNPSCLAQHHRCFLPPPLTCTTHAGEPLSSCHQYPSHPIRSVSEAIDLYSALQDKEFQQGISQELKEVVEPSVEEQ [EBI-7842180]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 365-365, sequence length 324 [EBI-7842180]265-365 physical association physical association F1A mint gsg1-papolb 3 Tpap 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6168351: original sequence: 1-365 : MPFAVTTQGAQQPAPAPKQFGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDSFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEA Gsg1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B, F2D, F2E mint gsg1-papolb-1 3 Tpap 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6168358: original sequence: 366-508 : SFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKETADKEEFRTMWVIGLVLKKPENSEILSIDLTYDIQSFTDTVYRQAINSKMFEMDMKIAAMHLRRKELHQLLPNHVLQKKET Gsg1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B, F2D, F2E mint papolb-gsg1-1 6 Tpap 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Gsg1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2C mint gsg1-papolb-2 1 Gsg1 11 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Tpap 10 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F3 mint gsg1-papolb-3 4 Tpap 10 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gsg1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F6 mint gsg1-hspa5 4 Gsg1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Grp78 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4 homomint mint hspa5-papolb 4 Tpap 10 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Grp78 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F6 mint clgn-gsg1 2 Gsg1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level TPAP 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Calmegin 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F5A homomint mint papolb-gsg1-2 7 Tpap 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6168369: original sequence: 366-508 : SFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKETADKEEFRTMWVIGLVLKKPENSEILSIDLTYDIQSFTDTVYRQAINSKMFEMDMKIAAMHLRRKELHQLLPNHVLQKKET Gsg1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2D mint papolb-gsg1-3 7 Tpap 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6168365: original sequence: 1-365 : MPFAVTTQGAQQPAPAPKQFGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDSFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEA Gsg1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2D mint