IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ FIT interacts with AtbHLH38 and AtbHLH39 in regulating iron uptake gene expression for iron homeostasis in Arabidopsis. FIT interacts with AtbHLH38 and AtbHLH39 in regulating iron uptake gene expression for iron homeostasis in Arabidopsis. Cell Res. (1001-0602) 2008 Yuan Y., Wu H., Wang N., Li J., Zhao W., Du J., Wang D., Ling HQ. The data used to map the FIT1 protein to a UniProt accession number was obtained from references provided in the text. hqling@genetics.ac.cn 16-April-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yuan Y., Wu H., Wang N., Li J., Zhao W., Du J., Wang D., Ling HQ. The data used to map the FIT1 protein to a UniProt accession number was obtained from references provided in the text. hqling@genetics.ac.cn Accepted 2008-APR-12 by ORCHARD. Cell Res. (1001-0602) 2008 orchard FIT interacts with AtbHLH38 and AtbHLH39 in regulating iron uptake gene expression for iron homeostasis in Arabidopsis. FIT interacts with AtbHLH38 and AtbHLH39 in regulating iron uptake gene expression for iron homeostasis in Arabidopsis. Cell Res. (1001-0602) 2008 Yuan Y., Wu H., Wang N., Li J., Zhao W., Du J., Wang D., Ling HQ. The data used to map the FIT1 protein to a UniProt accession number was obtained from references provided in the text. hqling@genetics.ac.cn 16-April-2008: Contacted by JYOTI. orchard arath-leaf Arabidopsis thaliana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Yuan Y., Wu H., Wang N., Li J., Zhao W., Du J., Wang D., Ling HQ. The data used to map the FIT1 protein to a UniProt accession number was obtained from references provided in the text. hqling@genetics.ac.cn Accepted 2008-APR-12 by ORCHARD. 16-April-2008: Contacted by JYOTI. Cell Res. (1001-0602) 2008 orchard org2_arath Transcription factor ORG2 F24I3.50 At3g56970 ORG2 BHLH38 EN8 Transcription factor EN 8 OBP3-responsive gene 2 bHLH transcription factor bHLH038 Basic helix-loop-helix protein 38 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCALVPSFFTNFGWPSTNQYESYYGAGDNLNNGTFLELTVPQTYEVTHHQNSLGVSVSSEGNEIDNNPVVVKKLNHNASERDRRKKINTLFSSLRSCLPASDQSKKLSIPETVSKSLKYIPELQQQVKRLIQKKEEILVRVSGQRDFELYDKQQPKAVASYLSTVSATRLGDNEVMVQVSSSKIHNFSISNVLGGIEEDGFVLVDVSSSRSQGERLFYTLHLQVENMDDYKINCEELSERMLYLYEKCENSFN 9DE64B574869394A fit_arath Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR FIT BHLH29 EN43 FIT1 FRU Transcription factor EN 43 Transcription factor Fe-DEFICIENCY INDUCED TRANSCRIPTION FACTOR 1 FER-LIKE REGULATOR OF IRON UPTAKE bHLH transcription factor bHLH029 Basic helix-loop-helix protein 29 F24D13.5 At2g28160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGRVNALSNINDLELHNFLVDPNFDQFINLIRGDHQTIDENPVLDFDLGPLQNSPCFIDENQFIPTPVDDLFDELPDLDSNVAESFRSFDGDSVRAGGEEDEEDYNDGDDSSATTTNNDGTRKTKTDRSRTLISERRRRGRMKDKLYALRSLVPNITKMDKASIVGDAVLYVQELQSQAKKLKSDIAGLEASLNSTGGYQEHAPDAQKTQPFRGINPPASKKIIQMDVIQVEEKGFYVRLVCNKGEGVAPSLYKSLESLTSFQVQNSNLSSPSPDTYLLTYTLDGTCFEQSLNLPNLKLWITGSLLNQGFEFIKSFT 153B7D71E11A7619 org3_arath Transcription factor ORG3 F24I3.60 At3g56980 ORG3 BHLH39 EN9 Transcription factor EN 9 OBP3-responsive gene 3 bHLH transcription factor bHLH039 Basic helix-loop-helix protein 39 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCALVPPLFPNFGWPSTGEYDSYYLAGDILNNGGFLDFPVPEETYGAVTAVTQHQNSFGVSVSSEGNEIDNNPVVVKKLNHNASERDRRRKINSLFSSLRSCLPASGQSKKLSIPATVSRSLKYIPELQEQVKKLIKKKEELLVQISGQRNTECYVKQPPKAVANYISTVSATRLGDNEVMVQISSSKIHNFSISNVLSGLEEDRFVLVDMSSSRSQGERLFYTLHLQVEKIENYKLNCEELSQRMLYLYEECGNSYI 2AE6CBF05422D3E0 at2g28160-at3g56970 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 1 FIT interacts with AtbHLH38 or AtbHLH39 at3g56970-at2g28160 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Figure 1 FIT interacts with AtbHLH38 or AtbHLH39 at3g56980-at2g28160 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Figure 1 FIT interacts with AtbHLH38 or AtbHLH39 at2g28160-at3g56980 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Figure 1 FIT interacts with AtbHLH38 or AtbHLH39 at2g28160-at3g56970- 2 4 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component c-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2B These results clearly illustrate that FIT interacts with AtbHLH38 or AtbHLH39 in plant cells, while no interaction was observed between AtbHLH38 and AtbHLH39. at2g28160-at3g56980- 2 4 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component c-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Figure 2C These results clearly illustrate that FIT interacts with AtbHLH38 or AtbHLH39 in plant cells, while no interaction was observed between AtbHLH38 and AtbHLH39. at2g28160-at2g28160 2 4 unspecified role unspecified role neutral component neutral component c-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 2D These results clearly illustrate that FIT interacts with AtbHLH38 or AtbHLH39 in plant cells, while no interaction was observed between AtbHLH38 and AtbHLH39.