IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Plant Cell (1040-4651) 2007 imex curation Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr 16-Oct-2008: Contacted by JYOTI. orchard Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. I have added GO terms as requested Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr Accepted 2008-JUL-11 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Plant Cell (1040-4651) 2007 imex curation Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr 16-Oct-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr Accepted 2008-JUL-11 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Plant Cell (1040-4651) 2007 imex curation Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr 16-Oct-2008: Contacted by JYOTI. orchard Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag immunost anti tag immunostaining anti tag immunost Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. I have re-annotated EBI-1778172 in line with your comments above. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr Accepted 2008-JUL-11 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Interaction between SGT1 and Cytosolic/Nuclear HSC70 Chaperones Regulates Arabidopsis Immune Responses. Plant Cell (1040-4651) 2007 imex curation Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr 16-Oct-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom fingerprinting peptide massfingerprinting fingerprinting Noel LD., Cagna G., Stuttmann J., Wirthmuller L., Betsuyaku S., Witte CP., Bhat R., Pochon N., Colby T., Parker JE. Transgenic Arabidopsis plants (ecotype Landsberg erecta) expressing SGT1b protein which had a StrepII tag fused to its c-termini. Transgenic plants were either untreated or treated with bacterial pathogen Pseudomonas syringae pv tomato prior to affinity purification assay. parker@mpiz-koeln.mpg.de, laurent.noel@cea.fr Accepted 2008-JUL-11 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation hs704_arath Heat shock 70 kDa protein 4 HSP70-4 HSC70-4 HSP70 Heat shock cognate 70 kDa protein 4 Heat shock cognate protein 70-4 Heat shock protein 70-4 MED37C MED37_2 T16H11.7 T2E22.11 At3g12580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSAEEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQGAGPDMGGAGGMDDDTPAGGSGGAGPKIEEVD 33381E896461C5B9 sgt1a_arath Protein SGT1 homolog A SGT1A F9D16.40 At4g23570 Suppressor of G2 allele of SKP1 homolog A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKELADKAKEAFVDDDFDVAVDLYSKAIDLDPNCAEFFADRAQAYIKLESFTEAVADANKAIELDPSLTKAYLRKGTACMKLEEYRTAKTALEKGASITPSESKFKKLIDECNFLITEEEKDLVQPVPSTLPSSVTAPPVSELDVTPTAKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGKGPAVLPKPNVSSEVSQRPAYPSSKKVKDWDKLEAEVKKQEKDEKLEGDAALNKFFREIYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELKKWEI D23DBE83BC8ACFA5 hsp7c_arath Heat shock 70 kDa protein 3 HSP70-3 HSC70-3 HSC70-G7 Heat shock cognate 70 kDa protein 3 F11F8 F3L24.33 At3g09440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDAKMDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPIIAKMYQGGEAGGPAAGGMDEDVPPSAGGAGPKIEEVD 453268ED6E60E152 hs701_arath Heat shock 70 kDa protein 1 HSP70-1 ERD2 HSC70-1 Heat shock cognate 70 kDa protein 1 Heat shock cognate protein 70-1 Heat shock protein 70-1 MED37E MED37_4 Protein EARLY-RESPONSIVE TO DEHYDRATION 2 T22P11.90 At5g02500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD BD689BA0C936A420 hs901_arath Heat shock protein 90-1 HSP90-1 HSP83 F6N7.13 At5g52640 Heat shock protein 83 HSP81-1 Heat shock protein 81-1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKTTEKEISDDEDEDEPKKENEGEVEEVDEEKEKDGKKKKKIKEVSHEWELINKQKPIWLRKPEEITKEEYAAFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLSFVKGVVDSDDLPLNISRETLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSKNLKLGIHEDSQNRGKIADLLRYHSTKSGDEMTSFKDYVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD DIP protein P27323 original sequence version: 127 5B379E915757EC7B hs702_arath Heat shock 70 kDa protein 2 HSC70-2 HSC70-G8 Heat shock cognate 70 kDa protein 2 Heat shock cognate protein 70-2 Heat shock protein 70-2 MED37D MED37_3 T22P11.80 At5g02490 HSP70-2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKQDITGQPRALRRLRTACERAKRTLSSTAQTTIEIDSLYGGADFYSPITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHEIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPIIAKMYQGGAGGEAGGPGASGMDEDEAPPASGGAGPKIEEVD EDEC254DB06D9966 sgt1b_arath Protein SGT1 homolog B SGT1B EDM1 ETA3 At4g11260 RPR1 Protein ENHANCED DOWNY MILDEW 1 Protein ENHANCER OF TIR1-1 AUXIN RESISTANCE 3 Suppressor of G2 allele of SKP1 homolog B F8L21.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKELAEKAKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQANIKIDNFTEAVVDANKAIELEPTLAKAYLRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPSLPSSSTTPLATEADAPPVPIPAAPAKPMFRHEFYQKPEEAVVTIFAKKVPKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEVLSTKVEIRLAKAEIITWASLEYGKGQSVLPKPNVSSALSQRPVYPSSKPAKDWDKLEAEVKKQEKDEKLDGDAAMNKFFSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELKKWEY DIP protein Q9SUT5 original sequence version: 121 DIP protein Q9SUT5 original sequence version: 111 711172817DD349C3 rar1_arath Cysteine and histidine-rich domain-containing protein RAR1 RAR1 At5g51700 PBS2 RPR2 AtRAR1 CHORD domain-containing protein RAR1 Protein PPHB SUSCEPTIBLE 2 Protein REQUIRED FOR MLA12 RESISTANCE 1 MIO24.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVGSATKKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTLNTPGQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSSPDPAV DIP protein Q9SE33 original sequence version: 69 DIP protein Q9SE33 original sequence version: 61 F8F9D30B9BF3A51E sgt1b-hsc70_1 4 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminal StrepII tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2C Supplementary Figure 2 Therefore, HSC70-1 and HSC70-3 are two novel SGT1b-Strep interactors in healthy leaf tissue. Interaction was not dependent on challenge with bacterial pathogen Pseudomonas syringae pv tomato. sgt1b-hsc70_3 4 11 unspecified role unspecified role bait bait c-terminal StrepII tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Figure 2C Supplementary Figure 2 Therefore, HSC70-1 and HSC70-3 are two novel SGT1b-Strep interactors in healthy leaf tissue. Interaction was not dependent on challenge with bacterial pathogen Pseudomonas syringae pv tomato. sgt1b-hsc70_2-1 4 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminal StrepII tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2C Copurified HSC70 protein amounts were too low to perform the analysis with SGT1a-Strep. For SGT1b-Strep, HSC70-1 and HSC70-3 remained the principal interactors of SGT1b expressed under the control of its native promoter in both samples (Figure 2C; see Supplemental Figure 2 online). Weak but reproducible signals were also unambiguously identified as HSC70 isoforms 2 (CAB85986) and 4 (BAB02269) in the pathogen-treated samples only. Interaction was dependent on challenge with bacterial pathogen Pseudomonas syringae pv tomato. sgt1b-hsc70_4-1 4 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminal StrepII tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2C Copurified HSC70 protein amounts were too low to perform the analysis with SGT1a-Strep. For SGT1b-Strep, HSC70-1 and HSC70-3 remained the principal interactors of SGT1b expressed under the control of its native promoter in both samples (Figure 2C; see Supplemental Figure 2 online). Weak but reproducible signals were also unambiguously identified as HSC70 isoforms 2 (CAB85986) and 4 (BAB02269) in the pathogen-treated samples only. Interaction was dependent on challenge with bacterial pathogen Pseudomonas syringae pv tomato. sgt1b-hsc70_1-2 3 11 unspecified role unspecified role bait bait c-terminal StrepII tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4D Figure 5B The association between SGT1 and HSC70s was confirmed and analyzed further using Agrobacterium tumefaciens�mediated transient coexpression of Arabidopsis SGT1 (Strep-tagged) and HSC70-1 (hemagglutinin [HA]-tagged) domains in Nicotiana benthamiana followed by detection of StrepII copurified protein on immunoblots The authors concluded that an intact c-terminal "SGS domain is needed for efficient HSC70 binding in vivo" and that "effective SGT1b binding is probably only achieved with the complete HSC70-1 protein". Agrobacterium-mediated transient transformation. The mutant form of SGT1b lacking the c-terminal 36 amino acids was shown to bind less effectively to the P22953 protein. sgt1a-hsc70_1 3 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait c-terminal Strep II tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4D SGT1a accumulated to similar levels as SGT1b in N. benthamiana extracts but bound lower amounts of HSC70-1 protein Agrobacterium-mediated transient transformation. sgt1b-hsc70_1-4 1 11 unspecified role unspecified role bait bait region Cerulean (CFP derivative) tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 6B Subpools of SGT1b and HSC70 Localize to the Nucleus P22953 : Q9SUT5 Partical bombardment transformation. at5g51700-hsp81_1 2 9 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait physical association physical association Supplementary Figure 3A no suitable source text at5g51700-at4g11260 2 11 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait physical association physical association Supplementary Figure 3A HSP90-1 and RAR1 still interacted with SGT1beta3 tested in a yeast two-hybrid assay at4g11260-hsp81-1 2 11 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 57 55 physical association physical association Supplementary Figure 3B HSP90-1 and RAR1 still interacted with SGT1beta3 tested in a yeast two-hybrid assay