MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Ku recruits XLF to DNA double-strand breaks. Ku recruits XLF to DNA double-strand breaks. EMBO Rep. (1469-221X) 2008 imex curation Yano K., Morotomi-Yano K., Wang SY., Uematsu N., Lee KJ., Asaithamby A., Weterings E., Chen DJ. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-1br3 Homo sapiens 1br3 1br3 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Yano K., Morotomi-Yano K., Wang SY., Uematsu N., Lee KJ., Asaithamby A., Weterings E., Chen DJ. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2009-01-08 Only protein-protein interactions imex curation Ku recruits XLF to DNA double-strand breaks. Ku recruits XLF to DNA double-strand breaks. EMBO Rep. (1469-221X) 2008 imex curation Yano K., Morotomi-Yano K., Wang SY., Uematsu N., Lee KJ., Asaithamby A., Weterings E., Chen DJ. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yano K., Morotomi-Yano K., Wang SY., Uematsu N., Lee KJ., Asaithamby A., Weterings E., Chen DJ. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2008 2009-01-08 Only protein-protein interactions imex curation nhej1_human Non-homologous end-joining factor 1 Protein cernunnos XRCC4-like factor NHEJ1 XLF protein protein human Homo sapiens Human MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS BC5C68076A5E7A96 xrcc4_human DNA repair protein XRCC4 X-ray repair cross-complementing protein 4 XRCC4 protein protein human Homo sapiens Human MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI DIP protein Q13426 original sequence version: 140 DIP protein Q13426-1 original sequence version: 116 BE5FB99153479A4E xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI DIP protein P13010 original sequence version: 128 DIP protein P13010 original sequence version: 127 DIP protein P13010 original sequence version: 122 DIP protein P13010 original sequence version: 174 DIP protein P13010 original sequence version: 153 DIP protein P13010 original sequence version: 155 DIP protein P13010 original sequence version: 142 2363CA84834E74A3 h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 h2afx-nhej1 1 H2AX 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell XLF 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F1D homomint mint nhej1-xrcc4 2 XRCC4 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ku80 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level XLF 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association SF1B F4A homomint mint nhej1-xrcc4-1 2 XRCC4 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ku80 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level XLF 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association SF1B homomint mint