MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. EMBO J. (0261-4189) 2008 imex curation Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. EMBO J. (0261-4189) 2008 imex curation Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. 2009-01-08 Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. EMBO J. (0261-4189) 2008 imex curation Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. 2009-01-08 Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63101 original sequence version: 72 2164DF3793B45B7A h3_peptide-4 conserved AA 13-33 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GKAPRKQLATKAARKSAPATG An amino acid sequence which is not represented in UniProt E0920C5D5052DB29 1433e_mouse 14-3-3 protein epsilon Ywhae protein protein mouse Mus musculus Mouse MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 07817CCBD1F75B26 hist1h3a-ywhaz 2 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491804: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491802: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491806: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ direct interaction direct interaction F3 kd 35 micromolar mint hist1h3a-ywhaz-1 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491818: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491816: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491812: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491814: original sequence: 10-10 : MARTKQTARKSTGGKAPRK 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3 kd 61 micromolar mint hist1h3a-ywhaz-2 2 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491828: original sequence: 10-10 : MARTKQTARKSTGGKAPRK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491832: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491830: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ physical association physical association F3 kd 49 micromolar mint hist1h3a-ywhaz-3 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491860: original sequence: 29-29 : KQLATKAARKSAPATGGVKK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491862: original sequence: 26-39 : ARKSAPATGGVKK 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3 kd 30 micromolar mint hist1h3a-ywhaz-4 2 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491879: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491875: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491877: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ direct interaction direct interaction F3 kd 26 micromolar mint hist1h3a-ywhaz-5 2 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491899: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491893: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491895: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491897: original sequence: 10-10 : MARTKQTARKSTGGKAPRK direct interaction direct interaction F3 kd 40 micromolar mint hist1h3a-ywhae 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491909: original sequence: 14-14 : TKQTARKSTGGKAPRKQLAT phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491911: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491913: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ 14-3-3 protein epsilon 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3 kd 73 micromolar homomint mint hist1h3a-ywhaz-6 2 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491923: original sequence: 26-39 : ARKSAPATGGVKK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491925: original sequence: 29-29 : KQLATKAARKSAPATGGVKK direct interaction direct interaction F3 kd 23 micromolar mint hist1h3a-ywhae-1 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491937: original sequence: 29-29 : KQLATKAARKSAPATGGVKK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491935: original sequence: 26-39 : ARKSAPATGGVKK 14-3-3 protein epsilon 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3 kd 55 micromolar homomint mint hist1h3a-ywhaz-7 2 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491947: original sequence: 10-10 : MARTKQTARKSTGGKAPRK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491949: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491951: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F3 kd 42 micromolar mint ywhaz-hist1h3a 1 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1A Induction of phosphoacetylation increases histone H3 interaction with 14-3-3. mint hist1h3a-ywhaz-8 1 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491683: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491685: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F2A mint hist1h3a-ywhaz-9 1 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491697: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491693: original sequence: 10-10 : MARTKQTARKSTGGKAPRK 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F2A mint hist1h3a-ywhaz-10 1 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumoylated lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491711: original sequence: 10-10 : MARTKQTARKSTGGKAPRK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491709: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ physical association physical association F2A mint hist1h3a-ywhaz-11 1 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491718: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491720: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491722: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F2A mint hist1h3a-ywhaz-12 1 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491768: original sequence: 10-10 : MARTKQTARKSTGGKAPRK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491736: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491738: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491740: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK physical association physical association F2A mint hist1h3a-ywhaz-13 1 14-3-3 protein zeta 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491776: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491774: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ physical association physical association F2B mint hist1h3a-ywhaz-14 1 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491786: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491790: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491788: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ 14-3-3 protein zeta 4 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F2B mint hist1h3a-ywhaz-15 3 H3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified selenocysteine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491656: original sequence: 15-15 : KQTARKSTGGKAPRKQLATK phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm range MINT-6491654: original sequence: 11-11 : MARTKQTARKSTGGKAPRKQ binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6491659: original sequence: 2-21 : ARTKQTARKSTGGKAPRKQ 14-3-3 protein zeta 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F2C mint