MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. EMBO J. (0261-4189) 2008 imex curation Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. EMBO J. (0261-4189) 2008 imex curation Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. 2009-01-08 Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. EMBO J. (0261-4189) 2008 imex curation Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. 2009-01-08 Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells density sedimentation cosedimentation through density gradient density sedimentation immunostaining immunostaining Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release. EMBO J. (0261-4189) 2008 imex curation Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Mori Y., Higuchi M., Hirabayashi Y., Fukuda M., Gotoh Y. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation mk09_rat Mitogen-activated protein kinase 9 Mapk9 Jnk2 Prkm9 Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 SAPK-alpha p54-alpha protein protein rat Rattus norvegicus (Rat) Rat MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLEGCR Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells mint EE549B9F4F12F421 mk08_rat Mitogen-activated protein kinase 8 Mapk8 Jnk1 Prkm8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 SAPK gamma p54 gamma protein protein rat Rattus norvegicus (Rat) Rat MSRSKRDNNFYSVEIADSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPVSSPSVNDMSSMSTDPTLASD Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells. Phosphorylates heat shock factor protein 4 (HSF4) mint 04E388B4F94633D4 syt4_rat Synaptotagmin-4 Synaptotagmin IV Syt4 protein protein rat Rattus norvegicus (Rat) Rat MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEAKRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLENVTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHFTVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG 6AC88E00878936BB syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21707 original sequence version: 71 DIP protein P21707 original sequence version: 76 DIP protein P21707 original sequence version: 141 DIP protein P21707 original sequence version: 112 DIP protein P21707 original sequence version: 145 DIP protein P21707 original sequence version: 160 06CE28F04C97A722 mk10_rat Mitogen-activated protein kinase 10 Mapk10 Jnk3 Prkm10 Stress-activated protein kinase JNK3 c-Jun N-terminal kinase 3 SAPK-beta p54-beta protein protein rat Rattus norvegicus (Rat) Rat MSLHFLYYCSEPTLDVKIAFCQGFDKHVDVSSVVKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR mint Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. Required for stress-induced neuronal apoptosis and the pathogenesis of glutamate excitotoxicity 1B08210326F4EEDD jun_rat Transcription factor AP-1 Jun Rjg-9 Activator protein 1 V-jun avian sarcoma virus 17 oncogene homolog Proto-oncogene c-Jun protein protein rat Rattus norvegicus (Rat) Rat MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF mint Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3' AFD9DF7D7C791B58 mapk8-syt4 1 Jnk1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6379573: original sequence: 82-425 : KRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLENVTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHFTVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCD physical association physical association F2B homomint mint mapk9-syt4 1 Jnk2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6379583: original sequence: 82-425 : KRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLENVTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHFTVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B homomint mint mapk10-syt4 1 Jnk2 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6379599: original sequence: 82-425 : KRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLENVTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHFTVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B homomint mint syt4-mapk8 4 Jnk1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate P49185:p.Asp162Thr mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D T Tue Jul 12 10:15:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:12:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp162thr' Tue Jun 30 18:24:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp162Thr' range MINT-6379629: original sequence: 162-162 : LKPSNIVVKSDCTLKILDFG flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C F2D homomint mint syt4-mapk8-1 4 Jnk1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate P49185:p.Glu329Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:55:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:03:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu329asn' Tue Jun 30 15:52:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu329Asn' range MINT-6379661: original sequence: 329-329 : PYINVWYDPSEAEAPPPKIP flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49185:p.Asp162Thr mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D T Tue Jul 12 10:17:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:36:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp162thr' Tue Jun 30 19:04:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp162Thr' range MINT-6379635: original sequence: 162-162 : LKPSNIVVKSDCTLKILDFG P49185:p.Glu331Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:22:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:40:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu331asn' Tue Jun 30 16:34:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu331Asn' range MINT-6379664: original sequence: 331-331 : INVWYDPSEAEAPPPKIPDK P49185:p.Asp326Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:22:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:13:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp326asn' Tue Jun 30 17:46:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp326Asn' range MINT-6379658: original sequence: 326-326 : LQHPYINVWYDPSEAEAPPP Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C F2D homomint mint syt4-mapk8-2 4 Jnk1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49185:p.Glu331Asn mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:58:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:12:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu331asn' Tue Jun 30 16:05:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu331Asn' range MINT-6379674: original sequence: 331-331 : INVWYDPSEAEAPPPKIPDK P49185:p.Asp326Asn mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:23:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:06:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp326asn' Tue Jun 30 18:09:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp326Asn' range MINT-6379678: original sequence: 326-326 : LQHPYINVWYDPSEAEAPPP P49185:p.Glu329Asn mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:24:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:18:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu329asn' Tue Jun 30 19:23:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu329Asn' range MINT-6379676: original sequence: 329-329 : PYINVWYDPSEAEAPPPKIP Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C F2D homomint mint syt4-mapk10 4 Jnk3 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C homomint mint jun-mapk8-2 4 Jnk1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49185:p.Asp162Thr mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D T Tue Jul 12 10:08:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:27:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp162thr' Tue Jun 30 17:59:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp162Thr' range MINT-6379718: original sequence: 162-162 : LKPSNIVVKSDCTLKILDFG P49185:p.Asp326Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:08:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:25:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp326asn' Tue Jun 30 18:13:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp326Asn' range MINT-6379716: original sequence: 326-326 : LQHPYINVWYDPSEAEAPPP P49185:p.Glu331Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:09:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:46:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu331asn' Tue Jun 30 19:34:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu331Asn' range MINT-6379712: original sequence: 331-331 : INVWYDPSEAEAPPPKIPDK P49185:p.Glu329Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:09:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:40:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu329asn' Tue Jun 30 16:14:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu329Asn' range MINT-6379714: original sequence: 329-329 : PYINVWYDPSEAEAPPPKIP Jun 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6379728: original sequence: 1-79 : MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELER physical association physical association F2C F2E homomint mint jun-mapk8-3 4 Jnk1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49185:p.Glu329Asn mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:06:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:58:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu329asn' Tue Jun 30 18:59:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu329Asn' range MINT-6379746: original sequence: 329-329 : PYINVWYDPSEAEAPPPKIP P49185:p.Glu331Asn mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E N Tue Jul 12 10:06:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:33:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu331asn' Tue Jun 30 19:40:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu331Asn' range MINT-6379748: original sequence: 331-331 : INVWYDPSEAEAPPPKIPDK P49185:p.Asp326Asn mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:06:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:42:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp326asn' Tue Jun 30 19:51:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp326Asn' range MINT-6379744: original sequence: 326-326 : LQHPYINVWYDPSEAEAPPP Jun 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6379734: original sequence: 1-79 : MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELER gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C F2E homomint mint jun-mapk9-1 4 Jnk2 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Jun 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6379768: original sequence: 1-79 : MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELER physical association physical association F2C F2E homomint mint syt4-mapk8-3 4 Jnk1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syt4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6379789: original sequence: 82-275 : KRKAALPNLSLHLDLEKRDLNGNFPKTNPKAGSSSDLENVTPKLFPETEKEAVSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPVFDETFTFYGVPYPHIQELSLHFTVLSFDRFSRDDVIGEVLVPLSGIELSDGKMLMT gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint F2G syt1-syt4 2 Syt1 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Syt4 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F6A Cells were treated with NGF. homomint mint syt1-syt4-1 3 Syt1 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Syt4 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F7 homomint mint