IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Novel interaction partners of Bardet-Biedl syndrome proteins. Novel interaction partners of Bardet-Biedl syndrome proteins. Cell Motil. Cytoskeleton (0886-1544) 2008 Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. davet in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. [35-S]-Met was introduced in the coimmunopreciptation to aid visualization of the precipitated binding partners. oeffner@staff.uni-marburg.de Accepted 2008-NOV-20 by DAVET. 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. Cell Motil. Cytoskeleton (0886-1544) 2008 davet Novel interaction partners of Bardet-Biedl syndrome proteins. Novel interaction partners of Bardet-Biedl syndrome proteins. Cell Motil. Cytoskeleton (0886-1544) 2008 Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de Accepted 2008-NOV-20 by DAVET. 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. Cell Motil. Cytoskeleton (0886-1544) 2008 davet Novel interaction partners of Bardet-Biedl syndrome proteins. Novel interaction partners of Bardet-Biedl syndrome proteins. Cell Motil. Cytoskeleton (0886-1544) 2008 Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. davet human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de Accepted 2008-NOV-20 by DAVET. 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. Cell Motil. Cytoskeleton (0886-1544) 2008 davet Novel interaction partners of Bardet-Biedl syndrome proteins. Novel interaction partners of Bardet-Biedl syndrome proteins. Cell Motil. Cytoskeleton (0886-1544) 2008 Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de 14-Nov-2008: Contacted by JYOTI. A human fetal kidney cDNA library was used in this screening. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Oeffner F., Moch C., Neundorf A., Hofmann J., Koch M., Grzeschik KH. Synapse - Interactions of proteins with an established role in the presynapse. oeffner@staff.uni-marburg.de Accepted 2008-NOV-20 by DAVET. A human fetal kidney cDNA library was used in this screening. Cell Motil. Cytoskeleton (0886-1544) 2008 davet flot1_human Flotillin-1 FLOT1 protein protein human Homo sapiens Human MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA C69E5421E565F53A fhod1_human FH1/FH2 domain-containing protein 1 FHOD1 FHOS FHOS1 Formin homolog overexpressed in spleen 1 Formin homology 2 domain-containing protein 1 protein protein human Homo sapiens Human MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLFIRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGDIEEAPGAGGRRERRKPSSEEGKRSRRSLEGGGCPARAPEPGPTGPASPVGPTSSTGPALLTGPASSPVGPPSGLQASVNLFPTISVAPSADTSSERSIYKARFLENVAAAETEKQVALAQGRAETLAGAMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVPPPPPLPPPPPIKGPFPPPPPLPLAAPLPHSVPDSSALPTKRKTVKLFWRELKLAGGHGVSASRFGPCATLWASLDPVSVDTARLEHLFESRAKEVLPSKKAGEGRRTMTTVLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLGQLERRSRAAEESLRSLAKHELAPALRARLTHFLDQCARRVAMLRIVHRRVCNRFHAFLLYLGYTPQAAREVRIMQFCHTLREFALEYRTCRERVLQQQQKQATYRERNKTRGRMITETEKFSGVAGEAPSNPSVPVAVSSGPGRGDADSHASMKSLLTSRPEDTTHNRRSRGMVQSSSPIMPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSPRALAARERKRSRGNRKSLRRTLKSGLGDDLVQALGLSKGPGLEV DIP protein Q9Y613 original sequence version: 71 DIP protein Q9Y613 original sequence version: 128 E6C7AE1FB8DC3FC7 ef1a1_human Elongation factor 1-alpha 1 EEF1A1 EEF1A EF1A LENG7 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Leukocyte receptor cluster member 7 protein protein human Homo sapiens Human MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK DIP protein P68104 original sequence version: null DIP protein P68104 original sequence version: 134 D465615545AF686A k1c18_human Keratin, type I cytoskeletal 18 KRT18 CYK18 Keratin-18 PIG46 Cytokeratin-18 Cell proliferation-inducing gene 46 protein protein protein human Homo sapiens Human MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH DIP protein P05783 original sequence version: 186 DIP protein P05783 original sequence version: 175 1E5604C6BCC7A17A hsc20_human Iron-sulfur cluster co-chaperone protein HscB HSCB DNAJC20 HSC20 DnaJ homolog subfamily C member 20 protein protein human Homo sapiens Human MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL DIP protein Q8IWL3 original sequence version: 129 70CF499E58FFD1C2 acy1_human Aminoacylase-1 ACY1 N-acyl-L-amino-acid amidohydrolase protein protein human Homo sapiens Human MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS 293350CD7759826C bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS DIP protein Q9BXC9 original sequence version: 105 DIP protein Q9BXC9 original sequence version: 79 8FA1CDAED725BEAF bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D t4s20_human Transmembrane 4 L6 family member 20 TM4SF20 UNQ518/PRO994 protein protein human Homo sapiens Human MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSLTARKRACCNNRTGMFLSSLFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQIVIGFLGCLCGVSKRRSQIV 1718E0594997A1A1 dctn1_human Dynactin subunit 1 DCTN1 150 kDa dynein-associated polypeptide DAP-150 p150-glued p135 protein protein human Homo sapiens Human MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS DIP protein Q14203 original sequence version: null DIP protein Q14203 original sequence version: 143 DIP protein Q14203 original sequence version: 135 DIP protein Q14203 original sequence version: 140 DIP protein Q14203-1 original sequence version: 146 DIP protein Q14203-1 original sequence version: 112 6DCEA5E67856E4BC bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK DIP protein Q96RK4 original sequence version: 122 DIP protein Q96RK4 original sequence version: 90 59BC9B29355C8E3C exoc7_human Exocyst complex component 7 EXOC7 EXO70 KIAA1067 Exocyst complex component Exo70 protein protein human Homo sapiens Human MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVKLLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYGRNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLKQYSQHGLDGKKGGSNLIPLEGLLPCTPRGGLPGPWINAACVCAADISPGHEHDFRVKHLSEALNDKHGPLAGRDDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKAIVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA DIP protein Q9UPT5 original sequence version: 142 6B929762542854B6 bhmt1_human Betaine--homocysteine S-methyltransferase 1 BHMT protein protein human Homo sapiens Human MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ 557855B8CEDD0D54 epas1_human Endothelial PAS domain-containing protein 1 EPAS1 HIF2A MOP2 Member of PAS protein 2 Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 PASD2 Hypoxia-inducible factor 2-alpha HIF-1-alpha-like factor PAS domain-containing protein 2 Class E basic helix-loop-helix protein 73 protein protein human Homo sapiens Human MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT DIP protein Q99814 original sequence version: 115 DIP protein Q99814 original sequence version: 155 DIP protein Q99814 original sequence version: 157 DIP protein Q99814 original sequence version: 137 DIP protein Q99814 original sequence version: 135 4838989598234FC1 eif3a_human Eukaryotic translation initiation factor 3 subunit A EIF3A KIAA0139 EIF3S10 Eukaryotic translation initiation factor 3 subunit 10 eIF-3-theta eIF3 p167 eIF3 p180 eIF3 p185 protein protein human Homo sapiens Human MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR DIP protein Q14152 original sequence version: 79 DIP protein Q14152 original sequence version: 130 DIP protein Q14152 original sequence version: 111 DIP protein Q14152 original sequence version: 104 485C01B28D67EBBA pcm1_human Pericentriolar material 1 protein PCM1 protein protein human Homo sapiens Human MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKKKFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAELEKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDASTNPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQEKSYMKFLKKILARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQHKAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPAVPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMDKLLGELHTLRDQHLNNSSASPQRSVDQRSTSAPSASVGLAPVVNGESNSLTSSVPYPTASLVSQNESENEGHLNPSEKLQKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENRKDEETEESEYDSEHENSEPVTNIRNPQVASTWNEVNSHSNAQCVSNNRDGRTVNSNCEINNRSAANIRALNMPPSLDCRYNREGEQEIHVAQGEDDEEEEEEAEEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDTGVNEKAREKFYEAKLQQQQRELKQLQEERKKLIDIQEKIQALQTACPDLQLSAASVGNCPTKKYMPAVTSTPTVNQHETSTSKSVFEPEDSSIVDNELWSEMRRHEMLREELRQRRKQLEALMAEHQRRQGLAETASPVAVSLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDEEGDEDGYLSEGIVRTDEEEEEEQDASSNDNFSVCPSNSVNHNSYNGKETKNRWKNNCPFSADENYRPLAKTRQQNISMQRQENLRWVSELSYVEEKEQWQEQINQLKKQLDFSVSICQTLMQDQQTLSCLLQTLLTGPYSVMPSNVASPQVHFIMHQLNQCYTQLTWQQNNVQRLKQMLNELMRQQNQHPEKPGGKERGSSASHPPSPSLFCPFSFPTQPVNLFNIPGFTNFSSFAPGMNFSPLFPSNFGDFSQNISTPSEQQQPLAQNSSGKTEYMAFPKPFESSSSIGAEKPRNKKLPEEEVESSRTPWLYEQEGEVEKPFIKTGFSVSVEKSTSSNRKNQLDTNGRRRQFDEESLESFSSMPDPVDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIRYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSETGSDFSMFEALRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFERETHKISEQNDADNASVLSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTEAESNSNMRCTCRIIEDGDGAGAGTTVNNLEETPVIENRSSQQPVSEVSTIPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSITVKQRCKRKIEATGVIQSCAKEAKRILEDHGSPAGEIDDEDKDKDETETVKQTQTSEVYDGPKNVRSDISDQEEDEESEGCPVSINLSKAETQALTNYGSGEDENEDEEMEEFEEGPVDVQTSLQANTEATEENEHDEQVLQRDFKKTAESKNVPLEREATSKNDQNNCPVKPCYLNILEDEQPLNSAAHKESPPTVDSTQQPNPLPLRLPEMEPLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI DIP protein Q15154 original sequence version: 101 DIP protein Q15154 original sequence version: 124 4625B991A443B6F3 actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 park7_human Parkinson disease protein 7 PARK7 Oncogene DJ1 Parkinsonism-associated deglycase Maillard deglycase Protein DJ-1 Protein/nucleic acid deglycase DJ-1 protein protein human Homo sapiens Human MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD DIP protein Q99497 original sequence version: 102 4B21661B3A76BC67 bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA DIP protein Q8IWZ6 original sequence version: 95 DIP protein Q8IWZ6 original sequence version: 66 A7856647969713FF calca_human Calcitonin gene-related peptide 1 CALCA CALC1 Calcitonin gene-related peptide I Alpha-type CGRP protein protein human Homo sapiens Human MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA A003A1069260D9B8 aldob_human Fructose-bisphosphate aldolase B ALDOB ALDB Liver-type aldolase protein protein human Homo sapiens Human MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY DCE314E7AC5586CA pax2_human Paired box protein Pax-2 PAX2 protein protein human Homo sapiens Human MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH 7EA24F9EB8C843F8 bbs1-acy1 4 12 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. Table I. bbs1-aldob 4 25 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-bhmt 4 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-calca 4 24 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-dctn1 4 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-dj1 4 22 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-eef1a1 4 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-eif3 4 12 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-epas1 4 18 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-exoc7 4 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-fhod1 4 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-flot 4 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-hsc20 4 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-krt18 4 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-pax2 4 26 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs1-tm4sf2 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-actb 4 15 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-acy1 4 10 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-aldob 4 15 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-bhmt 4 17 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-calca 4 15 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-dctn1 4 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-eef1a1 4 7 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-eif3 4 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-epas1 4 15 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-exoc7 4 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-fhod1 4 15 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-flot 4 5 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-hsc20 4 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-krt18 4 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-pax2 4 26 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs4-pcm1 4 20 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table I. To identify cellular factors that interact with selected BBS proteins (BBS1, BBS2, BBS4, BBS7 we applied a stepwise approach: First, yeast two-hybrid screening was performed with BBS1 and BBS4 fused to the C terminus of the DNA binding domain of GAL4(BD) as bait. bbs2-acy1 4 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-aldob 4 11 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-bhmt 4 17 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-eef1a1 4 11 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-epas1-1 4 11 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-exoc7 4 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-fhod1 4 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-flot 4 11 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-hsc20 4 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-krt18 4 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs2-pax2 4 11 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs7-acy1 4 10 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs7-aldob 4 25 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs7-fhod1 4 6 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs7-flot 4 5 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs7-krt18 4 23 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs7-pax2 4 26 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association Table I. Subsequently, we addressed the question whether these clones will interact also with BBS2 and BBS7. Therefore, the coding sequences of BBS2 and BBS7 were cloned into pGBKT7, followed by sequencing analysis and the same control experiments as described above. bbs1-eef1a1-1 1 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2B. Radioactive in vitro translation of pGBKT7-p53 and pGADT7-T followed by coimmunoprecipitation using anti-c-myc-antibodies and protein A beads (BD Biosciences) served as positive control for the biochemical verification of selected BBS protein-prey interactions (Fig. 2). bbs4-epas1-1 1 18 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C. Radioactive in vitro translation of pGBKT7-p53 and pGADT7-T followed by coimmunoprecipitation using anti-c-myc-antibodies and protein A beads (BD Biosciences) served as positive control for the biochemical verification of selected BBS protein-prey interactions (Fig. 2). bbs1-aldob-1 1 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2D. Radioactive in vitro translation of pGBKT7-p53 and pGADT7-T followed by coimmunoprecipitation using anti-c-myc-antibodies and protein A beads (BD Biosciences) served as positive control for the biochemical verification of selected BBS protein-prey interactions (Fig. 2). bbs4-aldob-1 1 15 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey c-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2D. Radioactive in vitro translation of pGBKT7-p53 and pGADT7-T followed by coimmunoprecipitation using anti-c-myc-antibodies and protein A beads (BD Biosciences) served as positive control for the biochemical verification of selected BBS protein-prey interactions (Fig. 2). bbs2-aldob-1 1 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2D. Radioactive in vitro translation of pGBKT7-p53 and pGADT7-T followed by coimmunoprecipitation using anti-c-myc-antibodies and protein A beads (BD Biosciences) served as positive control for the biochemical verification of selected BBS protein-prey interactions (Fig. 2). bbs7-aldob-1 1 23 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2D. Radioactive in vitro translation of pGBKT7-p53 and pGADT7-T followed by coimmunoprecipitation using anti-c-myc-antibodies and protein A beads (BD Biosciences) served as positive control for the biochemical verification of selected BBS protein-prey interactions (Fig. 2). bbs1-aldob-2 3 25 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 12 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs2-aldob-2 3 11 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 25 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs4-aldob-2 3 15 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 25 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs7-aldob-2 3 23 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 25 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs1-exoc7-1 3 12 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 16 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs2-exoc7-1 3 16 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs4-exoc7-1 3 16 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 15 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs7-exo7 3 16 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 23 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs1-krt18-1 3 12 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs2-krt18-1 3 11 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs4-krt18-1 3 8 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 15 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs7-krt18-1 3 8 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 23 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs1-flot-1 3 5 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 12 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs2-flot-1 3 5 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs4-flot-1 3 5 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 15 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs7-flot-1 3 5 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 23 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs1-pax2-1 3 12 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 26 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs2-pax2-1 3 26 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs4-pax2-1 3 15 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 26 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs7-pax2-1 3 23 unspecified role unspecified role neutral component neutral component pds-red fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 26 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization Figure 4. Additionally, HeLa cells were cotransfected with BBS1, BBS2, BBS4, and BBS7 inserted into pDsRed and ALDOB-/EXOC7-/FLOT1-/KRT18-/PAX2-pEGFP. Colocalization of BBS proteins and their interactions partners was detectable at punctuate subcellular structures, suggesting partially overlapping protein expression at the microtubule-organizing center (Fig. 4). bbs1-aldob-3 2 25 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. bbs2-aldob-3 2 11 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II bbs4-aldob-3 2 15 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. bbs7-aldob-3 2 25 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. bbs1-eef1a1-2 2 12 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. bbs2-eef1a1-1 2 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. bbs4-eef1a1-1 2 15 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. bbs1-pcm1 2 20 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. BBS1 and PCM1 interaction was not detected with the Y2H method used for Table I but the interaction was detected under stricter conditions as described in Table II. bbs2-pcm1 2 20 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II. BBS2 and PCM1 interaction was not detected with the Y2H method used for Table I but the interaction was detected under stricter conditions as described in Table II. bbs4-pcm1-8 2 20 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Table II. Full length EEF1a1 and PCM1 proteins interacted with BBS1, BBS2, and BBS4. The results of experiments performed on full length clones are summarized in Table II.