MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase. Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase. EMBO J. (0261-4189) 2007 imex curation Hare S., Fischer W., Williams R., Terradot L., Bayliss R., Haas R., Waksman G. 2009-01-08 Only protein-protein interactions helpy Helicobacter pylori Campylobacter pylori anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hare S., Fischer W., Williams R., Terradot L., Bayliss R., Haas R., Waksman G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase. Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase. EMBO J. (0261-4189) 2007 imex curation Hare S., Fischer W., Williams R., Terradot L., Bayliss R., Haas R., Waksman G. 2009-01-08 Only protein-protein interactions helpy Helicobacter pylori Campylobacter pylori anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hare S., Fischer W., Williams R., Terradot L., Bayliss R., Haas R., Waksman G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase. Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase. EMBO J. (0261-4189) 2007 imex curation Hare S., Fischer W., Williams R., Terradot L., Bayliss R., Haas R., Waksman G. 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hare S., Fischer W., Williams R., Terradot L., Bayliss R., Haas R., Waksman G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation o25990_helpy Jag_N domain-containing protein HP_1451 protein protein helpy Helicobacter pylori Campylobacter pylori MQNFIEIKAKTLEEALIQASIALNCPIINLQYEVIQTPSKGFLSIGKKEAIILAGVKESVKEIKEESVKETNTKEIHQSAEEKKQKLETETPQEEIITPKPSKKNPKEESHSGDKLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVINDFNNE 1AF80D38A0174EFF q6vrm0_helpx Type IV secretion system protein virB11 C2R65_00735 HP0525 HPY1846_06315 EC518_00440 protein protein helpx Helicobacter pylori Campylobacter pylori MAEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLKNNGEWQPFDVRDRKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSPVTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIMEFIPKEERIISIEDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRMRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLANMSSSNSAARNIKFESLIEGFKDLIDMIVHINHHKQCDEFYIKHR mint 808ACD99D813549A o25990-q6vrm0 3 HP0525 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 HP_1451 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6177994: original sequence: 113-274 : GDKLHEIKQELKDLFSHLPYKINKVEVSLYEPGVLLIDIDGEDSALLIGEKGYRYKALSYLLFNWIHPTYGYSIRLEISTFLQNQEKVMDTQLQSVIMTVHEVGKGQMKAPDGVLTYIALKKLRKAFPNKYVSIKTNLNDEKYIVINDFNNE [EBI-7678097]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 274-274, sequence length 264 [EBI-7678097]113-274 Stoichiometry: 2.0 direct interaction direct interaction f3 f4 Crystals diffracted to 2.4 A. mint o25990-q6vrm0-1 1 HP0525 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level HP_1451 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7a mint q6vrm0-o25990 2 HP0525 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level HP_1451 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7b mint