MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Somatic cell type specific gene transfer reveals a tumor-promoting function for p21(Waf1/Cip1). Somatic cell type specific gene transfer reveals a tumor-promoting function for p21(Waf1/Cip1). EMBO J. (0261-4189) 2007 imex curation Liu Y., Yeh N., Zhu XH., Leversha M., Cordon-Cardo C., Ghossein R., Singh B., Holland E., Koff A. 2009-01-08 Only protein-protein interactions mouse-glia Mus musculus glia glial cell anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Liu Y., Yeh N., Zhu XH., Leversha M., Cordon-Cardo C., Ghossein R., Singh B., Holland E., Koff A. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Somatic cell type specific gene transfer reveals a tumor-promoting function for p21(Waf1/Cip1). Somatic cell type specific gene transfer reveals a tumor-promoting function for p21(Waf1/Cip1). EMBO J. (0261-4189) 2007 imex curation Liu Y., Yeh N., Zhu XH., Leversha M., Cordon-Cardo C., Ghossein R., Singh B., Holland E., Koff A. 2009-01-08 Only protein-protein interactions mouse-glia Mus musculus glia glial cell anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Liu Y., Yeh N., Zhu XH., Leversha M., Cordon-Cardo C., Ghossein R., Singh B., Holland E., Koff A. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI DIP protein P25322 original sequence version: 139 DIP protein P25322 original sequence version: 123 DIP protein P25322 original sequence version: 75 3A79736B4163251B cdk4-ccnd1-18 1 cyclin-D1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cdk4 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4c mint ccnd1-cdk4-12 2 cyclin-D1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Lys114Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:12:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:30:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys114ala' Tue Jun 30 16:53:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys114Ala' range MINT-6177247: original sequence: 114-114 : ATCMFVASKMKETIPLTAEK Cdk4 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4c f5a mint