UniProt UniProt http://www.uniprot.org Cis1/Atg31 is required for autophagosome formation in Saccharomyces cerevisiae. Cis1/Atg31 is required for autophagosome formation in Saccharomyces cerevisiae. Biochem. Biophys. Res. Commun. 356 (405-410) 2007 imex curation Kabeya Y., Kawamata T., Suzuki K., Ohsumi Y. Cells were incubated with 0.2ug/ml rapamycin for 3 h prior fluorescence microscopy. yohsumi@nibb.ac.jp 14-Nov-2008: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kabeya Y., Kawamata T., Suzuki K., Ohsumi Y. Cells were incubated with 0.2ug/ml rapamycin for 3 h prior fluorescence microscopy. yohsumi@nibb.ac.jp Accepted 2008-DEC-5 by JYOTI. Biochem. Biophys. Res. Commun. 356 (405-410) 2007 jyoti Only protein-protein interactions imex curation Cis1/Atg31 is required for autophagosome formation in Saccharomyces cerevisiae. Cis1/Atg31 is required for autophagosome formation in Saccharomyces cerevisiae. Biochem. Biophys. Res. Commun. 356 (405-410) 2007 imex curation Kabeya Y., Kawamata T., Suzuki K., Ohsumi Y. Cells were incubated with 0.2ug/ml rapamycin for 3 h prior fluorescence microscopy. yohsumi@nibb.ac.jp 14-Nov-2008: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kabeya Y., Kawamata T., Suzuki K., Ohsumi Y. Cells were incubated with 0.2ug/ml rapamycin for 3 h prior fluorescence microscopy. yohsumi@nibb.ac.jp Accepted 2008-DEC-5 by JYOTI. 14-Nov-2008: Contacted by JYOTI. Biochem. Biophys. Res. Commun. 356 (405-410) 2007 jyoti Only protein-protein interactions imex curation atg17_yeast Autophagy-related protein 17 ATG17 APG17 YLR423C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP 71504B6C76549B75 71504B6C76549B75 ampl_yeast Vacuolar aminopeptidase 1 APE1 API Aminopeptidase yscI LAP4 Leucine aminopeptidase IV Lysosomal aminopeptidase III Polypeptidase Vacuolar aminopeptidase I YSC1 YKL455 YKL103C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEEQREILEQLKKTLQMLTVEPSKNNQIANEEKEKKENENSWCILEHNYEDIAQEFIDFIYKNPTTYHVVSFFAELLDKHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGKNWRAEKGVGVIGSHVDALTVKLKPVSFKDTAEGYGRIAVAPYGGTLNELWLDRDLGIGGRLLYKKKGTNEIKSALVDSTPLPVCRIPSLAPHFGKPAEGPFDKEDQTIPVIGFPTPDEEGNEPPTDDEKKSPLFGKHCIHLLRYVAKLAGVEVSELIQMDLDLFDVQKGTIGGIGKHFLFAPRLDDRLCSFAAMIALICYAKDVNTEESDLFSTVTLYDNEEIGSLTRQGAKGGLLESVVERSSSAFTKKPVDLHTVWANSIILSADVNHLYNPNFPEVYLKNHFPVPNVGITLSLDPNGHMATDVVGTALVEELARRNGDKVQYFQIKNNSRSGGTIGPSLASQTGARTIDLGIAQLSMHSIRAATGSKDVGLGVKFFNGFFKHWRSVYDEFGEL 702A8C88A2124C24 702A8C88A2124C24 atg31_yeast Autophagy-related protein 31 ATG31 CIK1 suppressor protein 1 CIS1 Protein CIS1 PZD196 YD9335.08c YDR022C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTVTVYDKNVKYRLEENIKNNKGPSNDDQPAYNNESKSTDGSDYAMFPTNIKYIFEDNNDELVDSSDAALTAGIDKVGDELENVIIVQLDESGSLEDITLISDQYELLSHRTNSLSLEENQMRTLSSHGDDKSNDEEEELSVDSDRFRVDSDIELDVISQFCDLSPFLRDLSLNDLIKLYVTQNEQLQMLSNSV CC2396854F29D250 CC2396854F29D250 atg31-ape1 1 4 unspecified role unspecified role neutral component neutral component n-terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig.3B atg31-atg17 2 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4