IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. Plant Physiol. (0032-0889) 2007 imex curation Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp 16-April-2008: Contacted by JYOTI. Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis BiFC was performed in 6-week-old Nicotiana benthamiana plants mkawai@iam.u-tokyo.ac.jp Accepted 2008-APR-18 by JYOTI. 16-April-2008: Contacted by JYOTI. Plant Physiol. (0032-0889) 2007 Only protein-protein interactions imex curation Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. Plant Physiol. (0032-0889) 2007 imex curation Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp 16-April-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp Accepted 2008-APR-18 by JYOTI. Plant Physiol. (0032-0889) 2007 Only protein-protein interactions imex curation Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. Plant Physiol. (0032-0889) 2007 imex curation Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp 16-April-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag immunost anti tag immunostaining anti tag immunost Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp Accepted 2008-APR-18 by JYOTI. 16-April-2008: Contacted by JYOTI. Plant Physiol. (0032-0889) 2007 Only protein-protein interactions imex curation bi1_arath Bax inhibitor 1 BI-1 K14A3.7 At5g47120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEEKKKKRRN FD3AAEA713363945 calm_horvu Calmodulin CAM protein protein horvu Hordeum vulgare (Barley) Barley MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK F52AF0516677508D calm7_arath Calmodulin-7 CAM7 T28A8.100 At3g43810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK EB2B188A90AD508D bl_1-cam 2 5 unspecified role unspecified role prey prey region C-terminal ubiquitin tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1644611]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 248-248, sequence length 247 [EBI-1644611]234-248 region N-terminal ubiquitin tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1B AtBI-1 interacts with CaM in yeast. bl_1-cam7 3 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region S-tag: LysGluThrAlaAlaAlaLysPheGluArgGlnHisMetAspSer tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1644625]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 248-248, sequence length 247 [EBI-1644625]234-248 ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Figure 2 Overlay assay reveals that Arabidopsis CaM protein interacts with the C-terminal region of AtBI-1. The interaction only occurred in the presence of 1 mM Calcium Chloride as noted by the authors "EGTA inhibited such binding, confirming the importance of calcium in CaM-mediated binding." Ethylene glycol tetraacetic acid (EGTA) bl_1-cam7-1 1 4 unspecified role unspecified role bait bait region NYFP N-terminal YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey region CYFP C-terminal yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Figure 3E When the AtBI-1 fused to the N-terminal yellow fluorescent protein (YFP) fragment and AtCaM7 fused with the C-terminal YFP were coexpressed in tobacco leaves, a strong BiFC signal was detected in the epidermal cells