UniProt UniProt http://www.uniprot.org An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Mar-2009: Contacted by JYOTI. BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Feb-2009: Contacted by JYOTI. human cDNA, not further specified BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Feb-2009: Contacted by JYOTI. BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Pohler JR., Otterlei M., Warbrick E. Cell line used was stably expressing EGFP-POLD3/p66. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Feb-2009: Contacted by JYOTI. BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Feb-2009: Contacted by JYOTI. BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Feb-2009: Contacted by JYOTI. BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. An in vivo analysis of the localisation and interactions of human p66 DNA polymerase delta subunit. BMC Mol. Biol. 2005 imex curation Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy immunostaining immunostaining Pohler JR., Otterlei M., Warbrick E. jrgpohler@hotmail.com jrgpohler@hotmail.com Accepted 2008-DEC-4 by DAVET. 03-Feb-2009: Contacted by JYOTI. BMC Mol. Biol. 2005 davet Only protein-protein interactions imex curation dpod2_human DNA polymerase delta subunit 2 POLD2 DNA polymerase delta subunit p50 protein protein human Homo sapiens Human MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP 389EF730999755AC dpod3_human DNA polymerase delta subunit 3 DNA polymerase delta subunit p66 POLD3 KIAA0039 DNA polymerase delta subunit C DNA polymerase delta subunit p68 protein protein human Homo sapiens Human MADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQSHLHMSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK DIP protein Q15054 original sequence version: 87 E9625E0188725F45 pcna_schpo Proliferating cell nuclear antigen pcn1 pcn SPBC16D10.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSMLIKSDGFEPYRCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNLVFESEKNDRISDYDVKLMDIDQEHLGIPDIEYDATITMPAAEFQRITRDLLTLSDSVTINASKEGVRFSCKGDIGNGSTTLKQHTDLSDQDQSIEISLTQAVTLTFSLKYLAQFTKATPLATRVTLSMSNDVPLLVEYKMESGFLRFYLAPKIGEEDEE 1EE5B2A27A899C4E 1EE5B2A27A899C4E pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS DIP protein P12004 original sequence version: 200 DIP protein P12004 original sequence version: 128 DIP protein P12004 original sequence version: 139 DIP protein P12004 original sequence version: 185 DIP protein P12004 original sequence version: 102 DIP protein P12004 original sequence version: 105 DIP protein P12004 original sequence version: 158 E6F08E7EDBC48B00 pold3-pcn1 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1 pold2-pold3-1 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1 pold2-pold3-2 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1 pold3-pold2 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association no figure pold2-pold3-3 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association no figure, see fig 2 for POLD3/p66 prey construct pold3-pcna 3 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association EGFP-POLD3 (Q15054) full length was both transiently transfected or expressed by a stable cell line; interaction was seen in both cases. EGFP-POLD3 (Q15054) mutation constructs have been transiently transfected. 3A POLD3 construct p66NLS with a mutation 320ngg322 also interacts POLD3 construct p66delta11 lacking the c-terminal last 11 aa also interacts pold2-pold3-4 6 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 2B POLD3 construct p66NLS with a mutation 320ngg322 also interacts POLD3 construct p66delta11 lacking the c-terminal last 11 aa also interacts EGFP-POLD3 (Q15054) full length or different constructs have been transiently transfected pold2-pcna 4 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 3C POLD3/p66. Cells expressing increased levels of EGFP-POLD3/p66 show an increased interaction. pcna-pold3 5 9 unspecified role unspecified role neutral component neutral component region EYFP-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role neutral component neutral component region ECFP-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction POLD3 and PCNA constructs have been transiently co-transfected 6 pcna-pold3-1 7 9 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15054:p.Lys320_Arg322delinsAsnGlyGly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain KRR NGG Wed May 02 16:52:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg_arg320-322asn_gly_gly' Tue Jun 30 20:25:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys320_Arg322delinsAsnGlyGly' 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 Colocalization occurs at sites of DNA repair.