IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysing protein-protein interactions of the Myxococcus xanthus Dif signalling pathway using the yeast two-hybrid system. Analysing protein-protein interactions of the Myxococcus xanthus Dif signalling pathway using the yeast two-hybrid system. Microbiology (Reading, Engl.) (1350-0872) 2005 imex curation Lancero HL., Castaneda S., Caberoy NB., Ma X., Garza AG., Shi W. wenyuan@ucla.edu 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lancero HL., Castaneda S., Caberoy NB., Ma X., Garza AG., Shi W. wenyuan@ucla.edu Accepted 2008-NOV-22 by ORCHARD. Microbiology (Reading, Engl.) (1350-0872) 2005 orchard Only protein-protein interactions imex curation Analysing protein-protein interactions of the Myxococcus xanthus Dif signalling pathway using the yeast two-hybrid system. Analysing protein-protein interactions of the Myxococcus xanthus Dif signalling pathway using the yeast two-hybrid system. Microbiology (Reading, Engl.) (1350-0872) 2005 imex curation Lancero HL., Castaneda S., Caberoy NB., Ma X., Garza AG., Shi W. wenyuan@ucla.edu 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lancero HL., Castaneda S., Caberoy NB., Ma X., Garza AG., Shi W. wenyuan@ucla.edu Accepted 2008-NOV-22 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. M. xanthus genomic library Microbiology (Reading, Engl.) (1350-0872) 2005 orchard Only protein-protein interactions imex curation q1cxr1_myxxd difB MXAN_6695 protein protein myxxd Myxococcus xanthus (strain DK 1622) MSQTPSDNVDAKLKAAEDHLREVMLALPEVTEEFPWGHRTAKVKGKMFAILVLDNDGLGVTTKLPESNEAALTLPFTAPTGYGLGKSGWVSSHFKPGSEVPIGLLAQWIHESFRAVAPQKVLKALMAPGAAQAPKAKPAARKAKSAARKAKPAAKPAAPARTSAAAKPGAGAGKGGAAKRGVAAGRAVARTSAAGKKPASGKAAVGGKKSVAKPASAREGPTRRAGAKQTSTAKRGAAGSSRSKR 47DBEAA7A6E402ED q1cxr3_myxxd difD MXAN_6693 protein protein myxxd Myxococcus xanthus (strain DK 1622) MAKRVLVVDDAIFMRNMIKDIFASGGFEVVGEAANGLEAVEKYKELKPDLTTMDIVMPFKSGIEATREIIKADSSAVVIMCSALGQESLVMEAIEAGASDFIVKPFRAEDVLAVVKKVLGET 4D555ED2DE21FFDF q1cxr0_myxxd difA MXAN_6696 protein protein myxxd Myxococcus xanthus (strain DK 1622) MGLALTGWMYASDGLINFVFPALSAGGKDAVRIGVAIIITGAAAALLPSWLARVTRVKVLSRSAYEISQGDLSKPVAAEGGSKRDEIDELTGAITRMQENLRELVGKIQETAKSVADTAIDLQRSAENVNGSTEEVGSSMEKIAGGAESQSQLVSKASKVITEMAGSIQRTTASAEDAARTTAETSSAAEDGSKAARLAGDKVKKVFNRIESASQQVFAFGEKTQEISKIVDAITQVAQQTNLLALNATIEAARAGEYGRGFAVVADEVRKLAESAGRSAEQISKLARDISGQSTSVVSAMKEGIAELAEGREDLTNIVRSMGAITDTIRKGSEKVHLISESAREQLKGSEEMVTAIEEIKLVARNNASSTEAIQAVIQEQTAAVSRMTSLASELTNLSVELQSVVRSFRLGP D4064E613C48221A q1cxr4_myxxd Chemotaxis protein CheA difE MXAN_6692 protein protein myxxd Myxococcus xanthus (strain DK 1622) MTMDMSRYLGLFISEATDHLEALGRDLVELEREGSSSAVDSMFRHAHSVKGMASSMGFEPIAIVAHRVEDLVDAVRQDRGRLDRDLVDLLLTAADTMLAQVRAVAEGKQPDDSAALLTQLSQRVTTMTGQAPAATRVAKVTALKPEGGGSDGTGGGSDGSGTAGGSGTAGGSGTTGGAGGSGTTGGGSDGSGTTGGGPDGSGTAGGAGGSSGTTGGAGGGSGTAGGAGGSGPTGAGASPASTHGGGAAGSGTRSCVDGGSGAAGGSASPGVASGTGVDGAGPGPASPNLMNGGPGTSATSSAPNGAHGTSAPLSPDGATGGVVVPLSTRRASDVPGTDAGSAAPTPDLANSLKAAASAPLPETLAQRWAVRLRIAPTCQVPGVRAFLVHKRLTNLGTLVELRPALEELKAGRIPDGNIQLELETPAGEAGIHAALKNVAEVEVLSVKPAVAAPVVQPTLVPVPDGARASSDTASRTVRVRTELLDYFLDTVGELMLATARLREVGKVLPENTRPALEEGVYRLHTLVKDLHDKVMTARMTPLSLITDRLPRAARDIARRKEREVDLVITGAEIELDRAILEELSDPLLHLLRNCIDHGLEAPEDRAAAKKGPRGRVLVAVKRARDRVIIELEDDGRGMDPAKLKNAAVSRGLLSAEAAVRLTDREAFMLSCLPGVSTAKDITDISGRGVGMDAVKRVVENVGGTLEIDSERGRGTRFTLRLPLTVAVVHLLLVEVGEEVFGLPIAKVVGATEADGESLSRSRETALLPHGNSLLPVHSLDALVGVPAPRRLGARPFVVMDGDSGRVALAVDRLLGQEEVVLKPLSRPLDLLPGLSGVTILGSGRPVFILDVPRLLSA 0CA94314DD5AF420 diff_myxxd_protein Polyketide synthase type I protein protein myxxd Myxococcus xanthus (strain DK 1622) An amino acid sequence which is not represented in UniProt Similar to Q1RS54 q1ddd5_myxxd nla19 MXAN_1078 protein protein myxxd Myxococcus xanthus (strain DK 1622) MTDANTPPTRGRLLVVDDQRNMRATTALLLRAENYTVFEAATGEEALAQLASGSIDLLLTDLKMEPMDGLTLLRRALEVAPRLQVIMMTAFGSIESAVEAMRLGAYDYVTKPFKESELRYRVERALERARLQRDVDNLTTDFNQRHGLSALVGRSAAMRELTTRLMRVAQSDATVLIQGESGTGKELVARALHAHSRRKARSFVPVNCAAISESLLESELFGHAKGAFTGAVKSRRGLFEEADGGTLFIDEVTETSPTFQSKLLRALQEGEVRRVGESTALRVDVRIVAATNRDIELEVRDKRFRQDLYYRLNVVALRVPPLRERLEDVPALAEHFLERANARSPNPKRLSAAAVSHLMSYGFPGNVRELENLVEQAAALAEGDELLPEDFPVRQGRMTPAHGTPSVAFLDGQGGALGRNASAGPTLAQVVEEAERHAITQALERHGVDLARVADELGVSSTTLWRKMKRLNLRPPSELARE FDD1C56FC51B42F0 q1cxr2_myxxd difC MXAN_6694 protein protein myxxd Myxococcus xanthus (strain DK 1622) MRHVIFRVEKERYGLPLSAVREVVVPPERFTRVPRAPLAITGVMNLRGRVVTVVELRQLLSLPEGPTPPGRVVLLDRGRRDLGLLVTDVDGIEAVERVSTAPGKMTPAIRGVARLGGLGVTVLDPEGLDAAVVALFTHSK 39531AF62D5361F8 q1cvg1_myxxd Membrane protein insertase YidC yidC Foldase YidC Membrane integrase YidC Membrane protein YidC MXAN_7509 protein protein myxxd Myxococcus xanthus (strain DK 1622) MNDPLSPQSNDSQKRLLAALALSFAATAVYTFFFAPTPPPPGSEIPDAGVVATAPADAGTPPAVQPPEGGTGTGATAEAPPPPARKVELQRDEATYAFSSEGAGLTAAVLKGAKMREQQELTVTQGFQKLFGKEIPPAPQMDLARPTPGQPLPLAVSITGASPLPADLNYTLDEGAPGNADGVTFTGRRGPWEVVKTVKWPMDGFELSYTLQVRNTSGQPQSGELQVHHNRAIDPNFEHAPSFFGGVGNLSRSACWVGDKLQKMSPGDDHPDAEDTRGQIQFFGIDQQYFLSALYPLEGPRAGSCSFEATPTLRKVTASFPITAAPGETVTLRFGGYFGPKDTDLLAQVPGASLRAATGQTDATFHPPLAETVDFGIWAVICKVLLWVMKFFYGVTGNWGVAIILLTVVVKLVLLPLTYRSMVSMEEVKKLQPRMEEIRKKHADNREQQNLEIMKLYQEAKVNPLGGCLPLLIQMPVWIALFTALRNSFDIYGEPFIGPIWRDLTYKDPTYLLPLALGVSMVITQKMQPQMMDATQAKIMTWFLPIIFTLTLLQYPAGLSLYIFTNNILSIAQQYGLRKWLDRNKPQTGGGTPAVAGAGGRRK B711F84AB4C75398 difc-dife 1 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difc-dife-1 1 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difa-difc 1 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difa-difc-1 1 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difd-dife 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difd-dife-1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difd-diff 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difd-diff-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only. difc-dife-2 2 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 5 These data further validate the interactions between DifC and DifE, DifD and DifE, and DifF and DifD difc-dife-3 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Table 5 These data further validate the interactions between DifC and DifE, DifD and DifE, and DifF and DifD difd-dife-2 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 5 These data further validate the interactions between DifC and DifE, DifD and DifE, and DifF and DifD difd-dife-3 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 5 These data further validate the interactions between DifC and DifE, DifD and DifE, and DifF and DifD difd-diff-2 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 5 These data further validate the interactions between DifC and DifE, DifD and DifE, and DifF and DifD dife-nla19 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 5 Furthermore, the DifE bait was able to pull out Nla19 difb-yidc 2 10 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Table 5 difa-difa-1 1 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 4 DifA interacted with DifC, and DifC interacted with DifA and DifE. DifD interacted with two proteins, DifE and DifF, and DifE also interacted with two proteins, DifC and DifD. DifF interacted with DifD only.