UniProt UniProt http://www.uniprot.org Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Biochem. Biophys. Res. Commun. (0006-291X) 2005 imex curation Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp Accepted 2008-Not a month!-29 by DAVET. 03-Mar-2009: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2005 davet Only protein-protein interactions imex curation Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Biochem. Biophys. Res. Commun. (0006-291X) 2005 imex curation Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions rat-brain-cerebellum Rattus norvegicus brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp Accepted 2008-Not a month!-29 by DAVET. 03-Feb-2009: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2005 davet Only protein-protein interactions imex curation Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Biochem. Biophys. Res. Commun. (0006-291X) 2005 imex curation Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions rat-brain-cerebellum Rattus norvegicus brain_cerebellum [Cerebellar] confocal microscopy confocal microscopy immunostaining immunostaining Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp Accepted 2008-Not a month!-29 by DAVET. 03-Feb-2009: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2005 davet Only protein-protein interactions imex curation Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. Biochem. Biophys. Res. Commun. (0006-291X) 2005 imex curation Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp 03-Feb-2009: Contacted by JYOTI. davet Only protein-protein interactions bovin-adrenal medulla Bos taurus adrenal medulla cells adrenal medulla anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. fig 2A and B not curated, IP with unspecific preys of 33 and 35 kDa; the molecular weights of the two co-immunoprecipitated proteins appeared to correspond to those of CapZ-alpha and -beta (PMID: 12488317). yamakumi@mail.pharm.tohoku.ac.jp Accepted 2008-Not a month!-29 by DAVET. 03-Feb-2009: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2005 davet Only protein-protein interactions imex curation mtpn_bovin Myotrophin MTPN protein protein bovin Bos taurus (Bovine) Bovine MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ 9097FFDF61D329A2 capzb_bovin F-actin-capping protein subunit beta CAPZB CapZ beta protein protein bovin Bos taurus (Bovine) Bovine MHPCRRSLPFPLNCQLVKVGTADYGGASDQSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC E4029F1A53614719 capzb_rat F-actin-capping protein subunit beta Capzb CapZ beta protein protein rat Rattus norvegicus (Rat) Rat MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC E6466A68B1254FD0 mtpn_rat Myotrophin Mtpn Gcdp Protein V-1 Granule cell differentiation protein protein protein rat Rattus norvegicus (Rat) Rat MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ 9097FFDF61DB8BA2 mtpn-capzb 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association P62775: transfection 2C mtpn-capzb-1 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association DB-cAMP; treatment for 24h with 1 mM DB-cAMP stimulated the interaction. 5 mtpn-capzb-2 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association DB-cAMP; treatment for 6-24h with DB-cAMP stimulated the interaction. 4A and B forskolin; treatment for 6 to 12h stimulated the interaction; the interaction peaked for a 12h and decreased to initial levels for a 24h treatment. forskolin; treatment for 2h decreased the interaction. DB-cAMP; treatment for 2h decreased the interaction. Q3T0F7: transfection mtpn-capzb-3 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3B mtpn-capzb-4 3 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 3A Co-localization was observed in the soma and primary dendrites of Purkinje cells. In postnatal 14-day-old rats, co-localization was observed in glomerular synaptic junctions in the innergranule layer as well as in the cell bodies of Purkinje cells.