IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). Oncogene (0950-9232) 2004 Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain davet in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. To identify the residues phosphorylated by VRK1 in the c-Jun molecule a phosphoaminoacid analysis was carried out. plazozbi@usal.es Accepted 2008-JUL-13 by DAVET. 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain Oncogene (0950-9232) 2004 davet c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). Oncogene (0950-9232) 2004 Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es Accepted 2008-JUL-13 by DAVET. 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain Oncogene (0950-9232) 2004 davet c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). Oncogene (0950-9232) 2004 Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain davet human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es Accepted 2008-JUL-13 by DAVET. 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain Oncogene (0950-9232) 2004 davet c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK). Oncogene (0950-9232) 2004 Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es 25-Jun-2008: Contacted by JYOTI. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sevilla A., Santos CR., Barcia R., Vega FM., Lazo PA. plazozbi@usal.es Accepted 2008-JUL-13 by DAVET. 23-4-2008: IBMCC-Centro de Investigacion del Cancer, CSIC-USAL, Spain Oncogene (0950-9232) 2004 davet vrk1_human Serine/threonine-protein kinase VRK1 Vaccinia-related kinase 1 VRK1 protein protein human Homo sapiens Human MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK 5640C624BF059949 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 vrk1-jun 4 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association In cells transfected with HA-c-Jun and VRK1-myc, the immunoprecipitation with anti-HA brings down VRK1 as detected in the immunoblot. The inverse situation, in the immunoprecipitate of VRK1, c-Jun is also detected with the anti-HA antibody 6A vrk1-jun-1 2 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association In cells transfected with HA-c-Jun and VRK1-myc, the immunoprecipitation with anti-HA brings down VRK1 as detected in the immunoblot. The inverse situation, in the immunoprecipitate of VRK1, c-Jun is also detected with the anti-HA antibody 6A vrk1-jun-2 3 5 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization both VRK1 and c-Jun are located in the nuclei, but outside the nucleolus. 1 vrk1-jun-3 1 5 enzyme enzyme unspecified role unspecified role Q99986:p.Lys179Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:23:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys179glu' Tue Jun 30 17:28:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys179Glu' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P05412:p.[Ser63Ala;Ser73Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 11:08:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser73ala,ser63ala' Wed May 02 16:38:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser63ala,ser73ala' Tue Jun 30 18:27:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser63Ala;Ser73Ala]' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation VRK1 phosphorylates c-Jun 2 Both Ser and Thr residues are phosphorylated. Most phosphorylation is at Ser63 and Ser 73.