UniProt UniProt http://www.uniprot.org Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. J. Biol. Chem. 278 (38352-38359) 2003 imex curation Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr mfontecabve@cea.fr 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr barras@ibsm.cnrs-mrs.fr Accepted 2008-Not a month!-9 by ORCHARD. 03-Mar-2009: Contacted by JYOTI. J. Biol. Chem. 278 (38352-38359) 2003 orchard Only protein-protein interactions imex curation Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. J. Biol. Chem. 278 (38352-38359) 2003 imex curation Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr mfontecabve@cea.fr 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. The activity was assayed from the amount of alanine formed from cysteine or selenocysteine. Selenocysteine solution was obtained after reduction of a 60 mM selenocystine-HCl solution with 10 mM dithiothreitol. barras@ibsm.cnrs-mrs.fr barras@ibsm.cnrs-mrs.fr Accepted 2008-Not a month!-9 by ORCHARD. 03-Mar-2009: Contacted by JYOTI. J. Biol. Chem. 278 (38352-38359) 2003 orchard Only protein-protein interactions imex curation Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. J. Biol. Chem. 278 (38352-38359) 2003 imex curation Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr mfontecabve@cea.fr 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr barras@ibsm.cnrs-mrs.fr Accepted 2008-Not a month!-9 by ORCHARD. 03-Mar-2009: Contacted by JYOTI. J. Biol. Chem. 278 (38352-38359) 2003 orchard Only protein-protein interactions imex curation cysteine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sufe_dicd3 Cysteine desulfuration protein SufE Dda3937_03664 sufE protein protein dicd3 Dickeya dadantii (strain 3937) Erwinia chrysanthemi (strain 3937) MAQLPDPQKLLRNFSRCSNWEEKYLYIIELGAGLAPLSDAQRQDGNRVSGCQSQVWIDLASNEQGNVVLHGDSDAAIVKGLIAIVFSLYQGLSVREIVELDVRPFFASLALTQHLTPSRSQGLEAMLRAVRARASALI D89144CCB51154F1 sufs_dicd3 Cysteine desulfurase sufS Selenocysteine lyase Selenocysteine reductase Selenocysteine beta-lyase Dda3937_03665 protein protein dicd3 Dickeya dadantii (strain 3937) Erwinia chrysanthemi (strain 3937) MNYPVEHYPIDRVRADFPILQQSVNGQPLAYLDSAASAQKPLAVIDRERDFYLHEYAAVHRGIHTLSARATSAMEEVRAKVATFIHAASAEDIVFVRGTTEAINLVANSYGRTAFQPGDNLVISEMEHHANIVPWQMLAQARGLTLRVLPITDDGELDMAQLPALLDERTRLVAVTQVSNVLGTVNPLAEIIRQAHACGAKVLVDGAQAVMHQAVDVQALDCDFYAFSGHKLYGPSGIGVLYGKSELLQAMPPWEGGGAMIREVSLTQGTTYADPPWRFEAGSPHVAGIIGLGAALDYVSALGVDAIQAHEGLLMRYALASLAEVPTLRLYGPVHRQGVIAFNLGRHHAFDVGSFLDQYGIAIRTGHHCAMPLMSRYGVPSMCRASLALYSCQDEIDRLVAGLHRIHRLLGE 422BFC09D104DD31 sufs-sufe 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 3 sufs-sufe-1 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 3 sufs-sufs 1 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 3 sufs-sufe-2 3 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fig. 4 sufs-cys-sufe 2 6 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 stimulator stimulator unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 enzyme target enzyme target substrate substrate unspecified role unspecified role enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig. 5, 6, 7 and Table III. Stimulation of sufS cysteine desulfurase activity by sufE Km and Vmax for cystein are respectively 0.5 mM and 0.9 units/mg. Km and Vmax for selenocystein are respectively 2 mM and 5 units/mg. Temp = 37C sufc-cys-1 2 6 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 enzyme target enzyme target substrate substrate unspecified role unspecified role enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig. 5, 6, 7 and Table III. SufS cysteine desulfurase activity. Km and Vmax for cysteine are respectively 0.5 mM and 0.019 units/mg. Km and Vmax for selenocysteine are respectively 2 mM and 5 units/mg. Temp = 37C