IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ In vivo interactions between gene products involved in the final stages of molybdenum cofactor biosynthesis in Escherichia coli. In vivo interactions between gene products involved in the final stages of molybdenum cofactor biosynthesis in Escherichia coli. J. Biol. Chem. (0021-9258) 2002 imex curation Magalon A., Frixon C., Pommier J., Giordano G., Blasco F. magalon@ibsm.cnrs-mrs.fr 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Magalon A., Frixon C., Pommier J., Giordano G., Blasco F. magalon@ibsm.cnrs-mrs.fr Accepted 2008-NOV-22 by ORCHARD. J. Biol. Chem. (0021-9258) 2002 orchard Only protein-protein interactions imex curation moea_ecoli Molybdopterin molybdenumtransferase moeA bisB chlE narE b0827 JW0811 protein protein ecoli Escherichia coli (strain K12) MEFTTGLMSLDTALNEMLSRVTPLTAQETLPLVQCFGRILASDVVSPLDVPGFDNSAMDGYAVRLADIASGQPLPVAGKSFAGQPYHGEWPAGTCIRIMTGAPVPEGCEAVVMQEQTEQMDNGVRFTAEVRSGQNIRRRGEDISAGAVVFPAGTRLTTAELPVIASLGIAEVPVIRKVRVALFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLEQLGCEVINLGIIRDDPHALRAAFIEADSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPGKPFAFGKLSNSWFCGLPGNPVSATLTFYQLVQPLLAKLSGNTASGLPARQRVRTASRLKKTPGRLDFQRGVLQRNADGELEVTTTGHQGSHIFSSFSLGNCFIVLERDRGNVEVGEWVEVEPFNALFGGL DIP protein P12281 original sequence version: 141 DIP protein P12281 original sequence version: null 6DBBC2B4191F5951 mog_ecoli Molybdopterin adenylyltransferase yaaG mog chlG mogA b0009 JW0008 protein protein ecoli Escherichia coli (strain K12) MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEVVAAFRPKSARRDVSE 3610EBDB4BE97872 3610EBDB4BE97872 moba_ecoli Molybdenum cofactor guanylyltransferase Protein FA mobA chlB mob narB b3857 JW3829 GTP:molybdopterin guanylyltransferase Mo-MPT guanylyltransferase Molybdopterin guanylyltransferase Molybdopterin-guanine dinucleotide biosynthesis protein A Molybdopterin-guanine dinucleotide synthase protein protein ecoli Escherichia coli (strain K12) MNLMTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQEKR DIP protein P32173 original sequence version: null B79B32DD7348DD48 mobb_ecoli Molybdopterin-guanine dinucleotide biosynthesis adapter protein mobB b3856 yihC JW5575 Molybdenum cofactor biosynthesis adapter protein Molybdopterin-guanine dinucleotide biosynthesis protein B protein protein ecoli Escherichia coli (strain K12) MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG DIP protein P32125 original sequence version: null 41E0E4EFB2AE160C mog-moea 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 1 Interestingly, MoeA interacts with both MogA and MobA to result in significant complementation mog-moba 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 1 Interestingly, MoeA interacts with both MogA and MobA to result in significant complementation mog-moba-1 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association 1 Interestingly, MoeA interacts with both MogA and MobA to result in significant complementation moba-mobb 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 MobB interacts with MoeA, MogA, and MobA to varying extents moea-mobb 1 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 MobB interacts with MoeA, MogA, and MobA to varying extents mog-mobb 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 1 MobB interacts with MoeA, MogA, and MobA to varying extents moea-moea-1 1 2 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 1 dimeric state of both MobB and MoeA. mobb-mobb 1 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 MobB interacts with MoeA, MogA, and MobA to varying extents moba-moea 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 1 MoeA interactswith both MogA and MobA