UniProt UniProt http://www.uniprot.org Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. EMBO J. (0261-4189) 2001 Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. davet in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu Accepted 2008-OCT-22 by DAVET. 03-Mar-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2001 davet Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. EMBO J. (0261-4189) 2001 Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. davet dicdi Dictyostelium discoideum (Slime mold) Slime mold anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu Accepted 2008-OCT-22 by DAVET. 03-Mar-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2001 davet Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. EMBO J. (0261-4189) 2001 Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. davet dicdi Dictyostelium discoideum (Slime mold) Slime mold anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu Accepted 2008-OCT-22 by DAVET. 03-Mar-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2001 davet Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. EMBO J. (0261-4189) 2001 Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. davet dicdi Dictyostelium discoideum (Slime mold) Slime mold anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu Accepted 2008-OCT-22 by DAVET. 03-Mar-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2001 davet Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. EMBO J. (0261-4189) 2001 Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. faix@physiology.wisc.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. davet dicdi Dictyostelium discoideum (Slime mold) Slime mold anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Faix J., Weber I., Mintert U., Kohler J., Lottspeich F., Marriott G. Proteins were detected using 125-I labelled monoclonal primary antibodies. faix@physiology.wisc.edu Accepted 2008-OCT-22 by DAVET. 03-Mar-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2001 davet rgaa_dicdi Ras GTPase-activating-like protein rgaA rgaA DDB_G0287585 DG1029 rasGAP1 Developmental gene 1029 protein protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MNKEEYSDISDSESEEVHETNNHNEHEHEEEDDTPEIVVPERKFLKEDEDYSVPFPVMRECLVLLLQSRRILRDMMYYRFKMDRFLSGNLSVFEIQNLLHSQREDKESDWIAEIQELKRNLVSEVRRNHTLERDLNRLDKRIALLIKNRGNIQDVLADKAGLKAPKHKGDQKKPELINDPKKLEAYQNLFYLLQTEPKYLAGLVYLIQPEQMESFLGTVILTLFGDAFTPREEFLLLSLYRLSIQKEMANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYAAIISEQEIRTGEKSTLDRNVSHEKALEVPEVTKTIKARVDQLISICEQFLDGIISSLNRLPYGIRWICKQIYQIAEKNFTKSTQDEILKVIGYFIYYRFIQVAMVSPEEYDLVGREIHPTARKNLINVSKVLQALFNFAQFGSSEKHFIPLNGWITSHMGDIKNYLQEIIEVGEPEDYLQVDKYMELTQKTKPVIIISLPEICNTHQLISKNLDSLVAKGEKDDPMRIIMKELDEFGPPPDIAADDDREVQLTLSNKFQKTIEEELSPGESLLSQTKEMVISLLRALPTLPEQKDQSDEPPNLVDVLNKARQADPSLEPEIKKILDNLKKLEEYNLTTSADNYSSFLKAVALEVVNRAEIREQQKKEKQRLTTSLNNLRKHQKYLNEQIAQYNQYLQDCRLKHYQNKSKKKKKGDGAKVGPFKFSFSELHKKGVIVDSEVPQITRKKIKFVISSDTVGVFDVSAKMAGIDVQTMRLELDDLLELNSIGTTTLELDQITLDVNMTIHLLNKLFLY D892AE507715C67A gapa_dicdi Ras GTPase-activating-like protein gapA gapA DDB_G0269140 IQGAP-related protein gapA protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MEGLEIEDEDVILLDEDDDSSSSSTVNNSSSNIKNNGNTNNNIGNDDSNKVTLMTSLREKGWGSGMLVDKEKNQYGTIKSYKDDKSSPWFEERQVIATLYKARVLLHEMIYTKMNQERLLSGNLCVGEIQSLLNTQKEDVETDWIAEIQELKRNMVAEIRRNHLLERDVNKLDKRIALLIKHRSNIKDLLLEQNKGKKDKKKKGDDKAEYITLDQKQLESYQNLFYLLQTEPHYLAKLVTLIQADQMEDFLDTVFLTLFGDDFSPREEFLILSLFRLAIGQEMSRIKSAGDLLAVESVVPKMIITYTRRKQGHEFLKQIIAPILENNVVNAPDLNLELNAVQVYQNMISEQEIQTGAKSTLNRGLAEDQIIQLKEVQSILEPRVEKCIQICERFFTGIIQSLNRLPYGIRWICKQIQSIAQKNFDSKPDEIAKVIGYFVYYRFINLAIVTPDAFEILDKELSITSRKNLVNIAKVLQNLFTLKTFQNQGSERWMQPLNKWILSKTSIVRQYLEDLIQVTDPSEYLRVDKYNELTLKLNPVVVISLGEISQTHRLLIANLAALKMKEKEDPLELILKALPAPLEVVDENDREIQLTLINRFKENIEKEISISASLLAETKELVISVLRSIPIQQKQQQQQHDDEKRDDLISILQNAIKHGKETNNPQLSSNAEKIINNLKKMEAEGSIQSENNQYEGFIKVIALEVINRQEIREQQRKERMRLTIALRDLRKHQSYLNDQIQHYTSYLKDVLLHYGPKDKKKSTKPMKISFKELTKKGVIVESDIPKLSHGSTSFYISSDAPGIFDIEARIGVASVGTLSLSLDDLLDKSSAGIPYLKLENIVLDVNMTLHLLNRHFLKNI 9FA629B483DA53C4 ctxa_dicdi Cortexillin-1 ctxA Cortexillin I DDB_G0289483 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MAGKDWEIVQEKAFTAWVNSVLDKRGEKISDVGKDLSDGVKLIFFLELISSKKFNKKYDFEPKARINMIQNVALALKFLDEELKIKVQGIGSEDFVDNNKKMILGFLWTLYRKYRIAVISEGDKSSEEGLLLWCKNTTTGYDGVNITSFTKSFRDGLAFLALSHKFEPESFKFQEFEAMDPIARLNAAFDFAEKGLGVPKLLEAEEVMRGTTDERSLVLYTSLFFHAYRAKEEKARLESSKNEMANRLAGLENSLESEKVSREQLIKQKDQLNSLLASLESEGAEREKRLRELEAKLDETLKNLELEKLARMELEARLAKTEKDRAILELKLAEAIDEKSKLEQQIEATRIRGAAEAQGLGLLRKNLDTHVHDLLKWQKLTMENSSSSSIDDQIIVEVSGLPFGEQVKHLATKLEAENLAIMKLLNQKEDDLKAQKLKSSKSKK DIP protein Q54HG2 original sequence version: 44 9884C6BC15BEE958 ctxb_dicdi Cortexillin-2 ctxB Cortexillin II DDB_G0276893 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MDLNKEWEKVQEMAFTSWVNSVLEKRGCDKISDVSTDLSDGVKLIYFLESVSGKKFPKKFDLEPKTRIMRVQNLHLAMLFIDEDLKIKVQGVAAEEFVDNNKKMILGFLWTLYRKYRISVINEGDKSSEEGLLAWCKKTTEGYNNVNITGFKSSFRDGHGFLALAHKYDPTVFKYDEYEGHDNIARLNAAFDFAEKGLGIPKLLEAESLSKGNVDERSIVLYTSLFFHAFRAKEEREALEASQNSLNNKLASLEQSLEGEKHSQEELVKQKKDLEDALNKIREQNDNRNSRITDLQSKIDDALRGLDDEKLAKLDLESRLAKCEKDKAILELKLAEILDEKDRLEKKIDEDKKRAEAERLGLGLIRQHLAAQFSDIHKWQSFLEHPETVPYTGTPVDLDSELSSLSFEEQAKKLASKLESENILIEKYLNGKEEAKAAAKK CED37127A2F5CFD1 rac1a_dicdi Rho-related protein rac1A rac1A DDB_G0277869 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIISPSSFENVNGKWHPEICHHAPNVPIILVGTKLDMREDKETQDRLKEKKLYPISYEQGLAKMKEINAVKYLECSALTQKGLKTVFDEAIRAVINPPLSKKKKSSGGCNIL 718E2BDE338E0005 ctxa-rgaa-1 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 1B ctxa-rgaa-2 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 1C, 1F, 1J rac1a-rgaa-2 1 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey dicdi Dictyostelium discoideum (Slime mold) Slime mold 9 unspecified role unspecified role prey prey dicdi Dictyostelium discoideum (Slime mold) Slime mold 8 unspecified role unspecified role prey prey dicdi Dictyostelium discoideum (Slime mold) Slime mold physical association physical association Fig 3A, 4B Interaction between rac1A and rgaA is stimulated by GTP-gamma-S. Interaction between rac1A and ctxA requires either rgaA or gapA. Interaction between rac1A and ctxB requires either rgaA or gapA. rac1a-rgaa-3 1 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 3B Interaction between rac1A and rgaA is stimulated by GTP-gamma-S. Interaction between rac1A and ctxA requires rgaA and is stimulated by GTP-gamma-S. rac1a-ctxa-1 4 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P34144:p.Gly12Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G N Wed May 02 15:53:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asn' Tue Jun 30 15:55:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asn' dicdi Dictyostelium discoideum (Slime mold) Slime mold 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey physical association physical association Fig 3C rac1a-gapa-1 3 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P34144:p.Gly12Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G N Wed May 02 17:05:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asn' Tue Jun 30 19:16:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asn' dicdi Dictyostelium discoideum (Slime mold) Slime mold physical association physical association Fig 3D ctxa-ctxb-6 5 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 5D ctxb-ctxa-1 1 9 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fig 5E