IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Dlxin-1, a novel protein that binds Dlx5 and regulates its transcriptional function. Dlxin-1, a novel protein that binds Dlx5 and regulates its transcriptional function. J. Biol. Chem. (0021-9258) 2001 imex curation Masuda Y., Sasaki A., Shibuya H., Ueno N., Ikeda K., Watanabe K. kwatanab@nils.go.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Masuda Y., Sasaki A., Shibuya H., Ueno N., Ikeda K., Watanabe K. kwatanab@nils.go.jp Accepted 2008-SEP-19 by DAVET. J. Biol. Chem. (0021-9258) 2001 davet Only protein-protein interactions imex curation Dlxin-1, a novel protein that binds Dlx5 and regulates its transcriptional function. Dlxin-1, a novel protein that binds Dlx5 and regulates its transcriptional function. J. Biol. Chem. (0021-9258) 2001 imex curation Masuda Y., Sasaki A., Shibuya H., Ueno N., Ikeda K., Watanabe K. kwatanab@nils.go.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Masuda Y., Sasaki A., Shibuya H., Ueno N., Ikeda K., Watanabe K. kwatanab@nils.go.jp Accepted 2008-SEP-19 by DAVET. 14-Nov-2008: Contacted by JYOTI. mouse embryo (embryonic day 11) cDNA library J. Biol. Chem. (0021-9258) 2001 davet Only protein-protein interactions imex curation magd1_mouse Melanoma-associated antigen D1 Maged1 Nrage MAGE-D1 antigen Neurotrophin receptor-interacting MAGE homolog Dlxin-1 protein protein mouse Mus musculus Mouse MAQKPDGGAGLRGFQAEASVEDSALLVQTLMEAIQISEAPPTSQATAAASGPNASPQSSQPPTANEKADTEVSAAAARPKTGFKAQNATTKGPNDYSQARNAKEMPKNQSKAAFKSQNGTPKGPHAASDFSQAAPTGKSAKKSEMAFKGQNSTKAGPGTTYNFPQSPSANEMTNNQPKTAKAWNDTTKVPGADAQTQNVNQAKMADVGTSAGISEADGAAAQTSADGSQTQNVESRTIIRGKRTRKVNNLNVEENNSGDQRRASLASGNWRSAPVPVTTQQNPPGAPPNVVWQTPLAWQNPSGWQNQTARQTPPAARQSPPARQTPSAWQNPVAWQNPVIWPNPVIWQNPVIWPNPIVWPGPIVWPNPMAWQSTPGWQSPPSWQAPPSWQSPQDWQGPPDWQVPPDWSMPPDWSFPSDWPFPPDWIPADWPIPPDWQNLRPSPNLRSSSNSRASQNQGPPQPRDVALLQERANKLVKYLMLKDYTKVPIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLVILGIIFMNGNRATEAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARNRMGIGDEAVSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQAFTGPIIGPSGTATANFAANFGAIGFFWVE 224B82470816835A dlx4_mouse Homeobox protein DLX-4 Dlx4 Dlx7 Homeobox protein DLX-7 protein protein mouse Mus musculus Mouse MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM ECDC4D943E22364C dlx5_mouse Homeobox protein DLX-5 Dlx5 protein protein mouse Mus musculus Mouse MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY C53555610E9F8777 msx2_mouse Homeobox protein MSX-2 Msx2 Hox-8.1 Msx-2 Homeobox protein Hox-8-1 protein protein mouse Mus musculus Mouse MASPTKGGDLFSSDEEGPAVLAGPGPGPGGAEGSAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS F2F4528D6E9C951E dlx1-dlx5 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 HA-tagged Dlxin-1 (HA-Dlxin1) was coimmunoprecipitated with FLAG-tagged Dlx5 (F-Dlx5), Dlx7 (F-Dlx7), Msx2 (F-Msx2), and Dlxin-1 (F-Dlxin1), but not when the FLAG peptide was included in the precipitation The interaction was competed by Flag-DLX5 dlx1-dlx7 1 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 HA-tagged Dlxin-1 (HA-Dlxin1) was coimmunoprecipitated with FLAG-tagged Dlx5 (F-Dlx5), Dlx7 (F-Dlx7), Msx2 (F-Msx2), and Dlxin-1 (F-Dlxin1), but not when the FLAG peptide was included in the precipitation Flag-Dlx7 competed in this interaction dlx1-msx2 1 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 HA-tagged Dlxin-1 (HA-Dlxin1) was coimmunoprecipitated with FLAG-tagged Dlx5 (F-Dlx5), Dlx7 (F-Dlx7), Msx2 (F-Msx2), and Dlxin-1 (F-Dlxin1), but not when the FLAG peptide was included in the precipitation Flag-Msx2 competed in the interaction. dlx1-dlx1 1 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 HA-tagged Dlxin-1 (HA-Dlxin1) was coimmunoprecipitated with FLAG-tagged Dlx5 (F-Dlx5), Dlx7 (F-Dlx7), Msx2 (F-Msx2), and Dlxin-1 (F-Dlxin1), but not when the FLAG peptide was included in the precipitation FLAG-Dlx1 competed in the interaction. dlx5-maged 2 3 unspecified role unspecified role prey prey hexapeptide repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait del c sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A The shortest clone (clone 16) isolated in the two-hybrid screening encodes 18 out of the 25 repeats, and the sequence was included in all of the overlapping clones, suggesting that the WQXPXX repeat region represents the binding site of the N-terminal domain of Dlx5 (Fig. 2A). No significant homology to any protein sequences was found in the N-terminal part of Dlxin-1 by searching data bases.